KEGG   Rattus norvegicus (rat): 301563
Entry
301563            CDS       T01003                                 

Gene name
Mff, RGD1310230
Definition
(RefSeq) mitochondrial fission factor
  KO
K22076  mitochondrial fission factor
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rno03029]
    301563 (Mff)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    301563 (Mff)
SSDB
Motif
Pfam: Miff
Other DBs
NCBI-GeneID: 301563
NCBI-ProteinID: NP_001034104
RGD: 1310230
Ensembl: ENSRNOG00000048016
UniProt: Q4KM98
Position
9q34
AA seq 218 aa
MAEISRIQYEMEYTEGISQRMRVPEKLKVAPPNADLEQGFQDGVPNASVIMQVPERIVVT
GNNEDISFSRPADLDLIQSTPFKPLALKTPPRVLTLSERPLDFLDLERPPPTPQSEEIRA
VGRLKRERSMSENAVRQNGQLVRNDSMYGISSLDAAVEGASEDMSVVDAASLRRQIIKLN
RRLQLLEEENKERAKREMVMYSITVAFWLLNSWLWFRR
NT seq 657 nt   +upstreamnt  +downstreamnt
atggcagaaattagtcgaattcagtacgaaatggaatacactgaaggtattagtcagcga
atgagggtcccggaaaaattaaaagtagcaccaccaaatgctgacctggaacaagggttc
caagatggagttccaaatgccagtgtgataatgcaagtcccagagaggatcgtggttaca
ggaaataatgaagacatttccttttcaagaccagcagatcttgaccttatccagtccact
ccctttaaacctctggcgctgaaaacacctccacgtgtgctcacactgagtgagagaccg
ctagatttcctggatttagaaagaccacctccaactcctcaaagcgaagagatccgagca
gttggcaggctaaaaagagaacgctctatgagtgaaaatgctgttcgccagaatggacag
ttggtcagaaacgattccatgtatggcatttcaagcctagatgcagctgttgaaggagcg
tcagaggacatgtctgtggtagatgcggcttcattgagacgtcagataatcaaattaaac
agacgtctacaacttctggaagaggagaataaagagcgtgctaaaagagaaatggtcatg
tattcaattactgtagcgttctggctgcttaacagctggctctggtttcgacgctag

DBGET integrated database retrieval system