KEGG   Rattus norvegicus (rat): 301570Help
Entry
301570            CDS       T01003                                 

Gene name
Sp110
Definition
(RefSeq) SP110 nuclear body protein
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: HSR SAND
Motif
Other DBs
NCBI-GeneID: 301570
NCBI-ProteinID: NP_001029309
RGD: 1310173
Ensembl: ENSRNOG00000033747
UniProt: Q3KRF1
Position
9q35
AA seq 478 aa AA seqDB search
MFTLTKALEKALLQHFIYTKLDIAYAINKPFPFFEALRDNSFITERMYKESLEACQNLVP
LSKVVHNILTSLEQTFDPSMLLILFSKVNLREYPSLGAICRSFRNVGNAYEGRNRPAPTL
LGASTNPAEGCSFQTLLPQPRSQALPPSHLSSGLRIRDPGTTSLQITEILDEQPSPSHPA
APLPGYIREGKTTPVSSRDHQRKDKEDSQEMPHHPSGPEAVVKDILTSKTNNRDDSGAQP
PGSPGTMHVVQDNSPAPNDPEVPQEAPCTPANKKARKRKSCIWSNSKRRRQKKKPPQHKM
MGVASPGPGVQEKLKVVGQRTLNQDDSTRNVKVVTRTLRERTRCAQTSSSQEISKEASKP
RARKRPQKRPHTAGRTIHVPEKSKDDAVDFLSPTLSVTCGEARGTLFKEKLKQGSSEKCI
QNEAGAWLTVKEFLKKGGKATSKDWKKAIRCNKKTLRSLEQDGFLFCTSKSKPQKECD
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgttcaccctgaccaaggccttggaaaaggctcttcttcagcatttcatatacacgaag
ctggacatcgcctatgccatcaacaagccgttccccttctttgaagcactccgagacaat
tccttcatcactgagcgaatgtacaaggaatctctggaagcctgtcaaaatctggtccct
ctatccaaagtggtgcacaatattctcaccagtctggagcagactttcgacccatcgatg
ctgctgatattgttcagcaaagtcaacctacgggaataccccagtctgggggcaatttgt
agaagcttcagaaatgttggcaatgcctatgaagggagaaacagacccgcaccaacccta
cttggagcctcaaccaacccagcagaagggtgctcctttcagactctgctgccacagccc
cgatcccaggcattgccaccaagtcatctgtcctctggactgagaatccgtgaccccgga
acaacctcactgcaaatcactgagatcctggatgagcagcccagcccttcccacccagct
gctcctctccctggctacattcgggaaggaaaaaccactccagtgtcctcaagagatcac
cagagaaaagataaggaagactctcaagagatgccccaccatccctcaggacccgaagca
gttgtcaaagacatcttaacatccaagactaacaatcgagatgactcaggagcacagcct
ccgggttctcctggcaccatgcatgtggttcaagataattctccagcaccaaatgacccg
gaagtgccccaggaagctccctgcacacctgcaaacaagaaagcaagaaaaagaaaaagt
tgcatctggtcaaattccaaaagaagacggcagaaaaaaaagccccctcaacataagatg
atgggagtggcctcacctggacctggagttcaggagaagctcaaggtggtggggcagagg
actctgaatcaggatgactcaactaggaacgtgaaggtagtgaccaggactctgagggaa
aggactcgctgtgcccagacatccagttctcaagagatcagcaaggaagcatcaaaacca
agggctagaaagaggcctcagaagaggccccacacagcaggaagaaccatacacgttcca
gaaaagtccaaggacgatgctgtggattttctctctcctacactctctgtgacctgtggt
gaggccagagggactttgttcaaagagaaactgaagcaaggatcctcagaaaagtgcatt
cagaatgaggcgggagcttggctgactgtaaaggagtttttaaagaaagggggaaaggcc
acgtcaaaagattggaagaaagctatccgttgtaacaagaagacattaagaagtctggag
caggatggatttttgttctgtacttccaaaagtaagcctcaaaaagagtgtgactag

DBGET integrated database retrieval system