KEGG   Rattus norvegicus (rat): 301626
Entry
301626            CDS       T01003                                 

Gene name
Pdcd1
Definition
(RefSeq) programmed cell death protein 1 precursor
  KO
K06744  programmed cell death protein 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04514  Cell adhesion molecules
rno04660  T cell receptor signaling pathway
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    301626 (Pdcd1)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    301626 (Pdcd1)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    301626 (Pdcd1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    301626 (Pdcd1)
CD molecules [BR:rno04090]
 Proteins
  301626 (Pdcd1)
SSDB
Motif
Pfam: V-set Ig_3 I-set ig Ig_2 OAD_gamma
Other DBs
NCBI-GeneID: 301626
NCBI-ProteinID: NP_001100397
RGD: 1311658
Ensembl: ENSRNOG00000049797
UniProt: D3ZIN8
Position
9
AA seq 287 aa
MWVQQVPWSFTWAVLQLSWQSGWLLEVLNKPWRPLTFSPTWLTVSEGANATFTCSFSNWS
EDLKLNWYRLSPSNQTEKQAAFCNGYSQPVRDARFQIVQLPNGHDFHMNILDARRNDSGI
YLCGAISLPPKAQIKESPGAELVVTERILETPTRYPRPSPKPEGQFQGLVIVIMSVLVGI
PVLLLLAWALAAFCSTGMSEAREAGRKEDPPKEAHAAAPVPSVAYEELDFQGREKTPEPA
PCVHTEYATIVFTEGLDASAIGRRGSADGPQGPRPPRHEDGHCSWPL
NT seq 864 nt   +upstreamnt  +downstreamnt
atgtgggtccagcaggtaccctggtcattcacttgggctgtgctacagttgagctggcaa
tcagggtggcttctagaggtcctcaataagccctggaggcccctcaccttctccccaacc
tggctcacagtgtcagagggagcaaatgccaccttcacctgcagtttctccaactggtcg
gaggatcttaagctgaactggtaccgtctgagtcccagcaaccagactgaaaaacaggcc
gccttctgcaatggttacagccagcccgtccgggatgcccgcttccagatcgtacaactg
cccaacggacatgacttccacatgaacatcctcgatgcacggcgcaatgacagtggcatc
tacctctgtggggccatctccctgcctcccaaggcacaaatcaaagagagtcctggagca
gagcttgtggtaacagagagaatcctggagaccccaacaagatatcccagaccctcaccc
aagccagaaggccagtttcaaggcttggtcattgtcatcatgagcgtcctagtgggtatc
cccgtgttgctgctgctggcctgggctctcgctgccttctgctcaacaggtatgtcagag
gccagagaagctggacgcaaggaagaccctccgaaggaggcgcatgcagcagcccctgtt
cccagtgtggcctacgaggagctggactttcagggacgagagaagacaccagagcctgcc
ccctgtgtgcacacagaatacgccaccattgtcttcactgaaggactggatgcctcagcc
ataggacgtaggggctcagctgatggcccacagggtcctcggcctccaagacatgaggat
ggacactgctcttggcctctttga

DBGET integrated database retrieval system