KEGG   Rattus norvegicus (rat): 301676Help
Entry
301676            CDS       T01003                                 

Gene name
Foxn2, RGD1562291
Definition
(RefSeq) forkhead box N2
  KO
K09407  forkhead box protein N
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    301676 (Foxn2)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix developmental regulators
    301676 (Foxn2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Forkhead
Motif
Other DBs
NCBI-GeneID: 301676
NCBI-ProteinID: XP_006225728
RGD: 1562291
Ensembl: ENSRNOG00000040110
UniProt: F1LZM0
Position
6q12
AA seq 428 aa AA seqDB search
MGPVIGMTPDKRAETPGAEKVAGLSQIYKMGSLPEAGEASRPKATLVGSDSTDDELTNLN
WLHESSDLLTNLRLGGEGLPMVSPLYDIEGDDMPSFGPLCCQNPEKKSATSKPPYSFSLL
IYMAIEHSPNKCLPVKEIYSWILDRFPYFATAPTGWKNSVRHNLSLNKCFQKVERSHGKV
NGKGSLWCVDPEYKPNLVQALKKQPFSSPQSASLSPHYLSSVLKQSQVQTLKESDIDAAT
AMILLNTSIEQEMLECEKPLPLKTSLQKKRSYGSAFSAPSAVQLQESHSPASSIDPKADH
NYSASGVAAQRCASRASMSSLSSVDEVYEFIPKSSHGGSDGSEGFHSDEETDAEDEDPLA
DSGYAPQALEDSTRKGQPGQKIPKQSCQEIDEELKEAAGSLLHLAGIRTCLGSLISTAKA
QSQKHRKK
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgggtccagtaattggaatgactccggataagagagctgagaccccgggagctgagaag
gttgcaggactgagtcagatttacaaaatggggagtttgcctgaagctggggaagcttcc
aggccaaaggccactctagtgggcagtgactccacagatgacgaactaacaaacttgaac
tggcttcatgagagtagtgaccttctaaccaacctcaggctcggcggtgaaggccttcca
atggttagcccattgtatgacatagagggagatgatatgccatcctttggaccattgtgc
tgccagaacccagaaaagaagtcagcaacttccaagcccccctactcctttagtcttctc
atttacatggccatcgaacactcgccaaataagtgcttgcctgtcaaagagatttacagc
tggatcctggatcgcttcccgtactttgccactgcacctacaggctggaagaattctgtt
cggcataatctatccctgaataaatgttttcagaaagtggaaagaagtcacggcaaggtt
aatggaaaaggctccttatggtgcgttgatccagaatataagcccaatcttgtgcaggcc
ttgaagaagcaaccgttttcctctccacaaagtgcttctttatcgcctcactacttaagc
tctgttctcaagcaaagtcaagtgcaaactcttaaagaatctgatattgatgctgccact
gcaatgatacttttaaatacttcaatagaacaagagatgttagagtgtgagaagcctctg
cctcttaaaacatcactgcagaaaaagaggagttacggcagcgcgttcagtgcccccagt
gctgtgcaactgcaggagagccattctccagcctccagcatcgacccaaaagcagaccat
aactacagtgccagcggcgtggcagcccagcgttgtgcatcgagggctagcatgtcttcc
ctgtcttctgtggatgaggtgtatgaattcatccccaagagtagccatggcgggagtgac
ggcagcgaaggcttccacagtgacgaggagacagatgctgaggatgaggatcctcttgca
gacagtggctatgcaccgcaagctcttgaagacagcactcggaaaggacagccaggccaa
aagattccaaaacagtcatgtcaagagatcgatgaggagctcaaagaagcagccgggtcg
ctgctccaccttgctggaatccgcacctgccttggctcccttataagtactgcaaaggca
caaagtcaaaaacaccggaaaaagtag

DBGET integrated database retrieval system