KEGG   Rattus norvegicus (rat): 302247
Entry
302247            CDS       T01003                                 

Gene name
RGD1304704, LRRGT00192
Definition
(RefSeq) similar to Hypothetical protein CGI-99
  KO
K15433  RLL motif containing protein 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rno03016]
    302247 (RGD1304704)
   03036 Chromosome and associated proteins [BR:rno03036]
    302247 (RGD1304704)
Transfer RNA biogenesis [BR:rno03016]
 Eukaryotic type
  tRNA spricing factors
   tRNA splicing ligases
    302247 (RGD1304704)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    302247 (RGD1304704)
SSDB
Motif
Pfam: RLL Cactin_mid
Other DBs
NCBI-GeneID: 302247
NCBI-ProteinID: NP_001041339
RGD: 1304704
Ensembl: ENSRNOG00000000340
UniProt: Q6QI16
Position
15p16
AA seq 296 aa
MFRRKLTALDYHNPTGFNCKARLNQDPNTAAAARRRSARFPAPRRLSGHLLGQQDETEFR
NFIVWLEDQKIRHYKIEDRGNLRNIHSSDWPKFFEKYLRDVNCPFKIQDRQEAIDWLLGL
AVRLEYGDNAIDVLLLSEAFEFGARGKAEKYKDSVPDNRKNADNAAKNSEPLINLDVNNP
DFKAGVMALANLLQIQRHDDYLVMLKAIRILVQERLTQDAVAKANQMKEGLPVALDKHIL
GFDTGDAVLNEAAQILRLLHIEELRELQTKINEAIVAVQAIIADPKTDHRLGKVGR
NT seq 891 nt   +upstreamnt  +downstreamnt
atgttccgacgcaagctcacggccctggattaccacaaccccacaggcttcaactgcaaa
gcccgcctgaaccaggacccaaacacggcggccgctgcccggcggcgttcggcacgcttc
ccggccccgaggcggctcagcgggcacctgctggggcagcaggatgaaacagagtttaga
aactttatcgtttggcttgaagaccagaagatcagacactacaagattgaagacagaggt
aacttgagaaacatccacagcagtgactggcccaagttctttgaaaagtatctcagagat
gttaactgtcctttcaagatccaggaccggcaagaagccattgactggctccttggctta
gctgttaggcttgaatatggagacaacgctattgatgttcttctgttatcggaagctttt
gaatttggtgcccgtggaaaagctgaaaagtacaaggactcagtgcctgacaacaggaaa
aacgctgacaacgcagctaaaaactcggagccattgatcaacctggacgtaaacaatcct
gattttaaggcgggtgtcatggctctggctaacctccttcagattcagcgtcacgatgac
tacttggtaatgctgaaggcaattcgaattttggttcaggaacggctaacacaggatgca
gttgctaaagcaaatcaaatgaaagagggcttacctgttgctttagacaaacatattctt
ggctttgacacaggcgatgcagttcttaatgaagctgctcagatcctgcggttgctacac
atagaagagctcagagagctacagacgaaaattaatgaagccatagtagccgttcaggcc
atcattgctgatccaaagacagaccacagactggggaaagttgggagatga

DBGET integrated database retrieval system