KEGG   Rattus norvegicus (rat): 302290
Entry
302290            CDS       T01003                                 

Gene name
Ap3s1
Definition
(RefSeq) adaptor-related protein complex 3, sigma 1 subunit
  KO
K12399  AP-3 complex subunit sigma
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    302290 (Ap3s1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    302290 (Ap3s1)
Membrane trafficking [BR:rno04131]
 Endosome - Lysosome transport
  Others
   AP-3 complex
    302290 (Ap3s1)
 Endosome - Golgi transport
    302290 (Ap3s1)
SSDB
Motif
Pfam: Clat_adaptor_s
Other DBs
NCBI-GeneID: 302290
NCBI-ProteinID: NP_001100403
RGD: 1311115
Ensembl: ENSRNOG00000003829
UniProt: G3V9Y9
Position
18q11
AA seq 157 aa
MIKAILIFNNHGKPRLSKFYQPYSEDTQQQIIRETFHLVSKRDENVCNFLEGGLLIGGSD
NKLIYRHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHVDKVHNIL
AEMVMGGMVLETNMNEIVTQIDAQNKLEKSESPRQDR
NT seq 474 nt   +upstreamnt  +downstreamnt
atgatcaaggccatcctcatcttcaacaaccacgggaagccgcggctctccaagttctac
cagccctatagtgaagatacgcaacagcaaatcatcagggagactttccatctggtgtct
aagcgagacgagaatgtttgtaatttcctagaaggaggattattaattggaggatctgac
aacaaactgatttacagacattatgcaacactatattttgtcttctgtgtggattcctca
gaaagtgaacttggcattttagatctaattcaagtatttgtggaaacattagacaaatgt
tttgaaaatgtctgtgagctggatttaatattccatgtagacaaggttcataatattctt
gcagaaatggtgatggggggaatggtattggagaccaacatgaatgagattgtcacacaa
attgatgcacaaaataaactggagaaatctgagtctcccagacaggacaggtag

DBGET integrated database retrieval system