KEGG   Rattus norvegicus (rat): 302328Help
Entry
302328            CDS       T01003                                 

Gene name
Pof1b, RGD1560798
Definition
(RefSeq) premature ovarian failure 1B
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: ATG16 Fez1 LRRFIP KASH_CCD HMMR_N CENP-F_leu_zip ADIP DUF724 MAP65_ASE1
Motif
Other DBs
NCBI-GeneID: 302328
NCBI-ProteinID: NP_001100404
RGD: 1560798
Ensembl: ENSRNOG00000004795
UniProt: D3ZWE3
Position
Xq31
AA seq 587 aa AA seqDB search
MMSSSYWSETSSSSCGTQQPTEVLQCQPQHYHCYHQSSQAQQPPEKNVVYERVRTYSGPM
NKVVQALDPLGSREVLSPLKPASSYQNLVWSDHSQELHSPTLKISTCAPSTLHITQNAEQ
ELHSPTVKVTTYPQTTIRRYIVQNPDQEPLSPFLRGGQFFPGNNVIYEKTIRKVEKLNTD
QECCPQIQCHHHVIQQPQIIHSPHCQQSHSSHQIQCITENDSNVGHELCHGGPSQIHEQL
IIQDDGPEKLDPKYFGELLADLSRKNTDLYHCLLEHLERIGGSKQDFETADTSEDIESLI
PKGLSEFTKQQIRYILQMRGMSDKSLRLVLSTFSNIREELGHLQNDLTSLENDKIRLEKD
LAFKENQIKEYEELLASVRANNRQQQQGLQDSSSKCQTLEENNLSLRHTLSDMEYRLKEL
EYCKRNLEQENKNLRIQVSETCTGSMLQGKMDEIGNHYMEMVKNLRLEKDREISKLRSQL
NQYQKDVSKREGSCSDFQFKLHELTSLLEEKDSLIKRQSEELSKLRQEIYSSHNQPSGGG
RTTITTKKYRTQYPILGLLYDDYEYIPPGSDTQTIVIEKTEDKWTCP
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgatgagctcaagttattggagtgagaccagcagcagcagttgtgggacccagcagccc
acggaggtcctgcagtgccagcctcagcattaccactgctaccatcagtcaagtcaagcc
cagcagcctccagaaaaaaatgtagtgtatgagcgagtgaggacctacagtgggcctatg
aacaaggtggtgcaggccttggaccccctcggctcacgggaagtgctctcccctctcaaa
ccagcctcctcctaccaaaatttggtttggagcgaccattctcaggagctccattctcca
actctgaaaatatctacttgtgcaccaagcactctccatataacacaaaatgctgaacag
gaactccattctccaacagtgaaagttactacatatccacaaaccaccattagaagatac
atagtacaaaatcctgaccaggaaccattgtcccctttcctaagaggaggtcaattcttc
ccaggaaacaatgtcatttatgaaaaaacaataagaaaagtggagaaactaaacacagat
caggaatgctgtcctcaaattcagtgccatcatcatgtcatccagcaaccccagatcatc
cactcaccacattgtcagcagtcccattctagccatcagatccaatgtataacagaaaat
gattcaaatgttgggcatgaactctgtcatggtgggccaagccaaatacatgaacagttg
ataattcaggatgatggccctgaaaaattggatcccaaatattttggagagttgcttgct
gacctgagccgcaagaatacagacctatatcactgcttgttagaacatttggagagaatt
ggaggaagcaaacaagattttgagactgcagatacatcagaagacattgagtcattgatt
cccaaaggactgtcagagtttacaaaacagcaaattcgttatattctgcagatgaggggt
atgtctgacaagtccctgcgactagtgctctccacattcagcaacatacgggaggaactt
ggacatcttcaaaatgatttgacatcactggaaaatgacaagataagacttgaaaaggac
ttggcattcaaggaaaatcaaataaaagagtatgaagaactcttggcatcagtgagagca
aataatcgccaacagcaacaaggacttcaagactcaagctcaaaatgtcagacattggaa
gaaaataacctttctcttcgacatacactgtcggacatggaatacagactaaaagaactt
gaatattgtaaacgtaatttagaacaagagaataaaaaccttagaatacaggtgtctgag
acttgcacgggctcgatgctacagggtaaaatggatgagattggcaaccattatatggag
atggtcaaaaacttgagacttgagaaagatagagaaatcagcaagctaaggtctcaatta
aaccagtaccaaaaagatgtttcaaaaagagaaggaagttgtagtgatttccaattcaaa
cttcatgaattgacaagtttgctggaagagaaggattctcttataaagcgtcaatcagag
gaactctcaaagttgagacaagaaatatattcatcccataaccaaccctctgggggtgga
aggactacaatcaccacaaaaaagtacagaacacagtatccaatcctaggtctcctgtac
gatgactatgaatatataccaccaggtagtgatacacaaactattgtgatcgagaaaaca
gaagacaaatggacttgtccataa

DBGET integrated database retrieval system