KEGG   Rattus norvegicus (rat): 302378
Entry
302378            CDS       T01003                                 

Gene name
Lpar4, Gpr23, RGD1563686
Definition
(RefSeq) lysophosphatidic acid receptor 4
  KO
K04275  lysophosphatidic acid receptor 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
rno04072  Phospholipase D signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04151  PI3K-Akt signaling pathway
rno04810  Regulation of actin cytoskeleton
rno05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    302378 (Lpar4)
   04072 Phospholipase D signaling pathway
    302378 (Lpar4)
   04151 PI3K-Akt signaling pathway
    302378 (Lpar4)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    302378 (Lpar4)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    302378 (Lpar4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    302378 (Lpar4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    302378 (Lpar4)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    302378 (Lpar4)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx Serpentine_r_xa 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 302378
NCBI-ProteinID: NP_001100410
RGD: 1563686
Ensembl: ENSRNOG00000002428
UniProt: D3ZHA3
Position
Xq22
AA seq 370 aa
MGDRRFIDFQFQDLNSSLRPRLGNATANNTCIVDDSFKYNLNGAVYSVVFILGLITNSAS
LFVFCFRMKMRSETAIFITNLALSDLLFVCTLPFKIFYNFNRHWPFGDTLCKISGTAFLT
NIYGSMLFLTCISVDRFLAIVYPFRSRTIRTRRNSAIVCAGVWILVLSGGISASLFSTTN
VNNATTTCFEGFSKRVWKTYLSKITIFIEVVGFIIPLILNVSCSSVVLRTLRKPATLSQI
GTNKKKVLKMITVHMAVFVVCFVPYNSVLFLYALVRSQAITNCLLERFAKIMYPITLCLA
TLNCCFDPFIYYFTLESFQKSFYINTHIRMESLFKTETPLTPKPSLPAIQEEVSDQTTNN
GGELMLESTF
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgggtgacagaagatttattgacttccaattccaagatttaaattcaagtctcagaccc
aggttgggaaatgcaactgccaataatacttgcattgttgacgactccttcaagtataat
ctgaatggtgctgtctatagtgttgtatttatcctgggcttaataaccaacagtgcttcc
ctgtttgtcttctgcttccgcatgaaaatgagaagtgagaccgctattttcatcaccaat
ctggccctctctgacttgctttttgtctgtaccctacctttcaaaatattttacaacttt
aaccgccactggccgtttggtgacaccctctgtaagatctcagggactgcattcctcacc
aacatctatgggagcatgctcttcctcacctgcattagtgtggatcgtttcctagccatt
gtctatcccttccgatctcgtaccatcaggaccaggaggaattccgccattgtgtgcgct
ggagtctggatcctagtcctcagtggtggtatttcagcgtctttgttttccaccactaac
gtcaacaatgcgaccaccacttgctttgaaggcttctccaaacgtgtctggaagacttac
ctgtccaagatcaccatattcattgaagttgttgggttcatcattcctctgatattgaat
gtttcctgctcttctgtggtgcttagaaccctccgcaagcctgcaacattgtctcaaatt
gggaccaataagaaaaaagtgttgaagatgatcacagtgcatatggcagtttttgtggta
tgcttcgtaccatataactctgttctctttttatatgccttggtacgttcccaagccatt
actaattgcttattggaaaggtttgcaaagataatgtacccgattaccttgtgccttgca
actctgaattgttgctttgacccttttatctattacttcactcttgaatcttttcagaaa
tccttttatatcaacacacacataaggatggagtcgctgtttaagactgagacacctctg
acccccaaaccttcccttccagctatccaagaggaagttagtgatcaaacaacaaataat
ggtggtgaactaatgctggaatccaccttctag

DBGET integrated database retrieval system