KEGG   Rattus norvegicus (rat): 302489
Entry
302489            CDS       T01003                                 

Gene name
Hs6st2, RGD1563872, RGD1564397
Definition
(RefSeq) heparan sulfate 6-O-sulfotransferase 2
  KO
K08102  heparan sulfate 6-O-sulfotransferase HS6ST2 [EC:2.8.2.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00534  Glycosaminoglycan biosynthesis - heparan sulfate / heparin
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00534 Glycosaminoglycan biosynthesis - heparan sulfate / heparin
    302489 (Hs6st2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rno01003]
    302489 (Hs6st2)
Enzymes [BR:rno01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.2  Sulfotransferases
    2.8.2.-  
     302489 (Hs6st2)
Glycosyltransferases [BR:rno01003]
 Unclassified
  Sulfotransferases
   302489 (Hs6st2)
SSDB
Motif
Pfam: Sulfotransfer_2
Other DBs
NCBI-GeneID: 302489
NCBI-ProteinID: NP_001178655
RGD: 1564397
Ensembl: ENSRNOG00000030880
UniProt: D3ZEK5
Position
Xq36
AA seq 660 aa
MALPAFAARALGPPLQPEQGAPARTTCPRRHSRVEAELAASRPGSVAASVRAGPPRGVSL
GFNSPPLQDKPPKTFSSLAGALRAPLFALLPRGRRRRMHDLRRRWDLGSLCRALLTRGLA
AVGHSLKHVLSAIFSKIFGPLASVGNMDEKSNKLLLALVMLFLFAVIVLQYVCPGTECQL
LRLQAFSSPVPDPYRSEDESSARFVPRYNFSRGDLLRKVDFDIKGDDLIVFLHIQKTGGT
TFGRHLVRNIQLEQPCECRVGQKKCTCHRPGKRETWLFSRFSTGWSCGLHADWTELTSCV
PAVVDGKRDARLRPSRWRIFQILDAASKDRWGSSNFNSGANSPSSTKPRSTTKSGKNFHY
ITILRDPVSRYLSEWRHVQRGATWKASLHVCDGRPPTSEELPSCYTGDDWSGCPLKEFMD
CPYNLANNRQVRMLSDLTLVGCYNLSVMPEKQRNKVLLESAKSNLKHMAFFGLTEFQRKT
QYLFEKTFNMNFISPFTQYNTTRASSVEINEEIQKRIEGLNFLDMELYSYAKDLFLQRYQ
FMRQKEHQDARRKRQEQRKFLKGRFLQTHFQSQSQSQGQSQGQSQGQSQGPGQNLSQNPN
PNPNQNLTQNLSQNLTQSSNPNLTQRENHGSQKQGSGQEQSDSSTSNGTNDYIGSVETWR
NT seq 1983 nt   +upstreamnt  +downstreamnt
atggcactgcctgcatttgcagcccgggcgcttgggccgccactgcaaccggagcaagga
gcgcccgcccgcaccacctgtccccgccggcattccagagtagaggccgaattggcagca
agccggcccgggtctgtcgccgcctcagtccgtgccggccctcctaggggtgtgtctctc
ggattcaactccccgccgctccaggacaagcccccaaagacattttcttccttggcggga
gccttgcgcgccccgctcttcgcgctgctgcctcgaggccgccgcaggcggatgcacgac
ctcaggcgacgctgggacctgggctccctctgccgggccctgctcactcggggcctggca
gctgtgggccactcgctcaagcacgtgctcagtgcgatcttctccaagattttcggtccc
ttggccagcgtcgggaacatggatgagaaatctaacaagctgctgctggctttggtgatg
ctcttcctatttgccgtgatcgtcctccaatacgtgtgccccggcacagaatgccagctc
ctccgcctgcaggcgttcagctccccggtgccggatccgtaccgctcggaggatgagagt
tccgccaggtttgtaccccgctacaatttcagccgtggcgatctcctgcgcaaggtagac
ttcgacatcaagggcgatgacctgatcgtgttcctgcacatccagaagactgggggcacc
actttcggccgtcacctggtgcgcaacatccagctggagcagccatgtgagtgccgcgtg
gggcagaagaaatgcacttgccaccggccgggtaagagggagacctggctcttctccagg
ttctccaccggctggagctgcgggctgcatgccgactggacggagctcaccagctgcgtg
cccgcagtggtggatggcaagcgcgacgccaggctgagaccttccaggtggaggattttt
cagattctagatgcagcaagtaaagatagatggggttcttcaaacttcaactcaggtgcc
aactctccatcctccacaaagccccggagcacaacgaagagtgggaagaacttccattat
atcaccatcctcagagacccagtgtctcggtacctgagcgaatggagacatgtccagagg
ggagcaacatggaaagcatccctgcacgtctgtgatggaaggcccccgacctctgaggaa
ctgcccagctgctacaccggtgatgactggtctggatgccctctcaaagagttcatggac
tgcccctataatctggccaacaaccgccaagtccgcatgctgtctgacctgactctagtg
ggctgctacaacctctctgtcatgcctgaaaagcaaagaaacaaagtccttttggaaagt
gccaaatccaatctgaagcacatggcattctttggcctcactgagtttcagcgcaagacc
cagtacctgtttgagaagaccttcaacatgaactttatttcgccgtttacccagtataat
accactagggcctctagtgttgagatcaatgaggaaatccaaaagcgtattgagggactg
aattttctggatatggagctgtacagctatgctaaagacctctttctgcaaaggtatcag
ttcatgaggcagaaagagcatcaggatgccaggcggaagcgtcaggagcaacggaaattt
ctgaagggaaggttccttcagacccatttccagagtcagagtcagagtcagggtcagagc
cagggtcagagccagggtcagagccagggtccaggtcagaatctgagtcagaatccaaat
cccaacccaaatcagaacctgactcagaatctgagtcagaatctgactcagagttcaaat
cccaatttgacccaaagggagaaccacggaagtcagaagcagggctcaggccaggagcag
agtgatagcagcaccagcaatggcaccaatgactacatagggagcgtagagacatggcgc
taa

DBGET integrated database retrieval system