KEGG   Rattus norvegicus (rat): 302499Help
Entry
302499            CDS       T01003                                 

Gene name
C1galt1c1, RGD1311230
Definition
(RefSeq) C1GALT1-specific chaperone 1
  KO
K09653  C1GALT1-specific chaperone 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00512  Mucin type O-glycan biosynthesis
rno00514  Other types of O-glycan biosynthesis
rno01100  Metabolic pathways
Module
rno_M00056  O-glycan biosynthesis, mucin type core
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    302499 (C1galt1c1)
   00514 Other types of O-glycan biosynthesis
    302499 (C1galt1c1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rno01003]
    302499 (C1galt1c1)
Glycosyltransferases [BR:rno01003]
 Glycan extension
  Type 3 chain
   302499 (C1galt1c1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 302499
NCBI-ProteinID: NP_001025204
RGD: 1311230
Ensembl: ENSRNOG00000002536
UniProt: Q499P3
Position
Xq35
AA seq 316 aa AA seqDB search
MLSESSSFLKGVMLGSIFCALITMLGHIRIGNRMHHHEHHHLQAPNKDDILKISETERME
LSKSFQVYCIVLVKPKDVSLWAAVKETWTKHCDKAEFFSSENVKVFESINMDTNDMWLMM
RKAYKYAYDKYKDQYNWFFLARPTTFAVIENLKYFLLRKDPSQPFYLGHTVKSGDLEYVS
VDGGIVLSIESMKRLNGLLSVPEKCPEQGGMIWKISEDKQLAVCLKYAGVFAENAEDADG
KDVFNTKSVGLFIKEAMTNQPNQVVEGCCSDMAVTFNGLTPNQMHVMMYGVYRLRAFGHV
FNDALVFLPPNGSEND
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgctttcagaaagcagttcatttttgaagggtgtgatgcttggaagcatcttctgtgcc
ttgatcactatgctaggccacattaggattggaaacagaatgcaccaccatgaacatcac
catctgcaagcccctaacaaagatgatatcttgaaaatttcagagactgaacgcatggag
cttagtaagagtttccaggtatactgtatagttctcgtaaaacctaaagatgtgagtctt
tgggctgcagtgaaggagacttggaccaaacactgtgacaaagcagaattcttcagttct
gaaaatgttaaagtgtttgagtcaattaatatggacacaaatgatatgtggttgatgatg
aggaaagcttacaaatatgcttatgataaatacaaggaccaatacaactggttcttcctt
gcacgccccactactttcgctgttattgaaaatctcaaatattttttgttaagaaaggat
ccatcacaacctttctatctaggtcacactgtaaaatctggagaccttgaatatgtgagt
gtggatggaggaattgtcttaagcatagaatcaatgaaaagactcaatggccttctcagt
gttcctgaaaagtgtcctgaacaaggaggaatgatttggaagatatctgaagataagcag
ctagcagtctgcctgaaatatgctggagtatttgcagaaaatgcagaagacgccgatgga
aaagatgtgtttaataccaaatctgttgggcttttcattaaagaggcaatgactaaccaa
ccaaaccaggtagtagaaggatgttgctctgatatggctgttactttcaatggactgact
cctaatcagatgcatgtgatgatgtatggggtgtaccggcttagggcatttggacatgtt
ttcaatgatgcattggttttcttacctccgaatggttctgagaatgactga

DBGET integrated database retrieval system