KEGG   Rattus norvegicus (rat): 302540Help
Entry
302540            CDS       T01003                                 

Gene name
Lancl3, RGD1563642
Definition
(RefSeq) LanC like 3
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: LANC_like
Motif
Other DBs
NCBI-GeneID: 302540
NCBI-ProteinID: NP_001178657
RGD: 1563642
Ensembl: ENSRNOG00000003756
UniProt: D3ZG98
Position
Xq12
AA seq 420 aa AA seqDB search
MDTKRCFANRFDDYQGSLLAGQCEEAVAPLVTSTIERILQELPPLGGGAEARGATAAGSS
CQGGLYSGVAGVAYMLYHVSQSPLFAAARERYLRSAKRLIDACSRAEEWGETDADTRAAF
LLGGAGVYAVATLVYHALGRSDYVQPLSKFRALCAVCAPVSFLECGSDELFVGRAGYLCA
ALVLKQKLAQEVLTPAQIKAICQAILDSGKQYALKKRKPFPLMYSYYGTEYLGAAHGLSS
ILQMLLSYHEHLKPSDRELVWQSVDFLMEQEQNCNWPPELGETIERENELVHWCHGAPGI
AYLFAKAYLISKKPQYLDTCIRCGELTWQKGLLKKGPGICHGVAGSAYVFLLLYRLTGNS
KYIYRAQRFAQFLFTEEFKAGSRVLESIYSLYEGFSGTVCFLIDLLQPNQAEFPLFSVFV
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggacaccaagcgctgcttcgccaaccgcttcgatgactaccagggcagcctgctggcg
ggccagtgcgaggaggcagtggcgcccttggtcacctccaccatcgaacgcatccttcag
gagctgcccccgctgggtggcggcgctgaggctcggggagcgacggccgcgggcagcagc
tgccaggggggtctgtacagcggtgtggctggggtggcctacatgctctaccacgtctcg
cagagcccgcttttcgccgccgcccgggagcgctacctgcgctccgccaagcgcctcatc
gacgcgtgctcacgcgccgaggagtggggcgagacggacgcggacacccgcgccgccttt
ctgctcgggggcgcgggcgtgtacgcggtggccacacttgtctaccacgccctgggccgc
tccgactatgtgcagcccctcagcaagttccgggctctgtgcgccgtctgcgctcctgtc
tccttcctggagtgcggctccgacgagctgttcgtgggccgcgctggctacctgtgcgct
gcgctcgtgctcaagcagaagcttgcccaggaggtattgactccagcacaaattaaagca
atatgccaggcaattctggactccggaaagcagtatgctctgaagaagagaaaaccattc
cccctgatgtattcttactatggaacggaatacctgggggcagctcatggcctgtcgtcc
attctccaaatgctcctttcttaccacgagcatctcaaaccttcagaccgggagctggtg
tggcagagtgtggacttcctcatggaacaggaacagaattgcaactggccaccagagctc
ggagagaccatcgagagagagaatgaactcgtccactggtgccatggcgctccaggaatt
gcttatctgtttgccaaagcttatctcatttccaagaagccgcagtatctggacacatgt
atccggtgtggggagctaacatggcagaaaggcctgttgaagaaggggccggggatctgc
cacggtgtagctggcagtgcatatgtcttccttcttctctaccgtcttacaggaaactcg
aagtacatctaccgtgcccaaaggtttgctcagttcttattcactgaagaattcaaagcc
ggttcacgggtccttgaaagcatatacagcttgtatgaaggcttctctgggactgtttgc
tttctcattgatcttctacagcccaatcaggctgaatttcctctcttcagcgtctttgtt
taa

DBGET integrated database retrieval system