KEGG   Rattus norvegicus (rat): 302552Help
Entry
302552            CDS       T01003                                 

Gene name
Tbc1d25, Oatl1, RGD1559711
Definition
(RefSeq) TBC1 domain family, member 25
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: RabGAP-TBC
Motif
Other DBs
NCBI-GeneID: 302552
NCBI-ProteinID: NP_001100425
RGD: 1559711
Ensembl: ENSRNOG00000005303
UniProt: B1WBS1
Position
Xq12
AA seq 688 aa AA seqDB search
MATTSAASDLACSAAPSPVGGASAAAAVEEEEREVVRVRVKKCESFLSPEFRSFAVDPQI
TSLDVLQHILIRAFDLNGKKNFGISYLARDRLGQEAFLSLLSDWDLSTAFATASKPYLQL
RVDIRPSEDSPLLEDWDIISPKDVIGSDVLLADKRSSLTTAALPFTQSILSQVGRTLSKV
QQVLSWSYGEDVKPFKPPLSDAEFHTYLNHEGQLSRPEELRLRIYHGGVEPSLRKVVWRY
LLNVYPDGLTGRERMDYMKRKSREYEQLKSEWAQRVNPEDLEFIRSTVLKDVLRTDRAHP
YYAGPEDGPHLRALHDLLTTYAVTHPQVSYCQGMSDLASPILAVMDHEGHAFVCFCGIMK
RLAANFHPDGRAMATKFAHLKLLLRHADPDFYQYLQEAGADDLFFCYRWLLLELKREFAF
DDALRMLEVTWSSLPPDPPEHEVELVGPPSQVADTGFGSHRGRPVRQRHMLRPAGGGSSA
FEDAVVHLATSSQGPSSGGRLLRQASLDGLQQLRDNMSPRKDLLVQLSHPATLISSKSLS
EPLLNSPDPLLSSSSRPDSPSSSSPPSTQEASPSGDVAVGSPSMPEVGSPRDPGKSVPPP
PPMGLPPPQEFGRGNPFMLFLCLAILLEHRDHIMRNGLDYNELAMHFDRLVRKHHLGRVL
RRAKALFADYLQSEVWDSEEGAEATAPS
NT seq 2067 nt NT seq  +upstreamnt  +downstreamnt
atggcaacaacctccgcggcctcggacttagcgtgctcggcagcgccctcgcccgtcgga
ggtgcctcggcagcagcggcggttgaagaggaggagcgtgaggtggtacgggtccgagtc
aagaaatgtgagagcttcttgtctcccgagttccgctcttttgctgtagatcctcagatc
acctcgctggacgtgttgcagcatatcctcatccgagcctttgacttgaatgggaagaag
aactttggcatcagctacctggcccgagaccggctcggacaggaagctttcctctccctc
ctttctgattgggacctcagcacagctttcgccaccgcctccaaaccttatttgcagttg
cgtgtagacattcggccctcagaggacagcccattgctggaggactgggacatcattagc
cccaaagatgtcattggatctgatgtgctactggccgacaagcggtcctcactgacgaca
gccgccttgcctttcacacagtccatcctgtctcaggtgggccgtacactgtctaaggtc
cagcaagtgctgagttggtcttatggagaagatgtcaagcctttcaagccacctctgagt
gatgccgagttccacacgtatctgaatcatgaaggtcagctctcccggcctgaggagttg
cgcttgaggatctaccacggcggtgtggagccttcacttcgaaaagtggtatggcgctac
ctcctgaatgtgtacccagatgggctgacaggccgtgagcggatggactacatgaaacgt
aagagccgcgagtacgagcagctcaaaagcgagtgggcccagcgagtgaaccctgaggac
ctggaattcatccgaagcacagtcctcaaggatgtgcttcgcacagaccgagcccatccc
tactatgcagggcctgaggatggcccacatctacgggccctccatgacttgctcactacc
tacgccgttacccacccacaggtatcgtactgccagggtatgagtgacctggcctcacca
attcttgccgtcatggaccacgaaggccatgcctttgtatgcttctgtggcatcatgaag
cgcctagctgccaacttccaccctgatggtcgtgccatggccaccaagtttgcccacctc
aagctgctgttgagacatgctgacccagacttctaccagtacctgcaggaagcgggtgcc
gatgacctctttttctgttaccgctggctgctgttggaacttaagcgggagttcgccttt
gatgatgctctccgaatgctagaagtcacctggagttcactgcctcctgaccctcctgaa
catgaagtggaactcgttggaccgcccagccaagtagcagacactggctttggtagccac
aggggacggccagtacgtcagaggcacatgctgaggcctgctggtggaggaagcagtgct
tttgaagacgctgttgtccacttagctacatctagccagggacctagtagtgggggacgt
ctcctaagacaggccagcctagatggtctccaacaactcagggataacatgagccccagg
aaggaccttctggtccaactatctcacccagctaccctcattagctccaagtccctgtcc
gagcccttgctgaattccccagatccactcctctcctcctcttctcggcccgattcccca
tcttcgtcgtctcctccatctacccaggaggcttccccttctggtgacgtagctgtagga
tccccctcgatgccagaggtagggtctcccagagaccctgggaagtctgtaccacctcca
cctccaatgggccttcccccaccccaggagtttggccgagggaacccattcatgctcttc
ctctgcctcgctatcctgctggagcatcgtgaccacatcatgcgcaatgggctggattac
aatgagctagccatgcattttgaccgcctggtgcggaaacaccatctagggcgagtcttg
cgcagagccaaggctctctttgctgattacctacagtctgaagtgtgggactctgaggag
ggggctgaggccacagctccatcttga

DBGET integrated database retrieval system