KEGG   Rattus norvegicus (rat): 302562Help
Entry
302562            CDS       T01003                                 

Gene name
Plp2, A4-LSB
Definition
(RefSeq) proteolipid protein 2
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: MARVEL AC_N PRA1
Motif
Other DBs
NCBI-GeneID: 302562
NCBI-ProteinID: NP_997484
RGD: 1587363
Ensembl: ENSRNOG00000039496
UniProt: Q6P742
Position
Xq12
AA seq 151 aa AA seqDB search
MADSERLSAPGCWLACTSFSRTKKGILLFAEIILCLVILICFSASTSAYSSLSVIEMIFA
AVLFVFYMCDLHSKISFINWPWTDFFRSLIAAILYLITSIVVLVEGRGSSKIVAGVLGLL
ATLLFGYDAYITFPLKQQRHTAAPTDPTDGP
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atggcggactctgagcgtctctcggctcccggctgctggttagcctgcaccagcttctcg
cgcaccaaaaagggaattctcctgtttgctgagattatactgtgcctggtgattttgatt
tgcttcagtgcctctacatcagcctactcctccctgtcggtgattgagatgatctttgct
gctgtcttatttgtcttctacatgtgtgacctgcactccaagatctcattcatcaattgg
ccttggaccgacttcttcagatccctcatagcagccatcctgtacctgatcacttccatt
gttgtccttgtagaaggacgaggcagctccaaaatcgtcgctggggtactgggcttactg
gctaccttgctctttggctacgatgcatacatcaccttccctctaaagcagcaaagacat
acagcagcccccactgaccccacagatggcccatga

DBGET integrated database retrieval system