KEGG   Rattus norvegicus (rat): 302591
Entry
302591            CDS       T01003                                 

Gene name
Nxf3
Definition
(RefSeq) nuclear RNA export factor 3
  KO
K14284  nuclear RNA export factor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03008  Ribosome biogenesis in eukaryotes
rno03013  RNA transport
rno03015  mRNA surveillance pathway
rno05014  Amyotrophic lateral sclerosis
rno05164  Influenza A
rno05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    302591 (Nxf3)
   03015 mRNA surveillance pathway
    302591 (Nxf3)
   03008 Ribosome biogenesis in eukaryotes
    302591 (Nxf3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    302591 (Nxf3)
   05168 Herpes simplex virus 1 infection
    302591 (Nxf3)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    302591 (Nxf3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    302591 (Nxf3)
   03009 Ribosome biogenesis [BR:rno03009]
    302591 (Nxf3)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     302591 (Nxf3)
   mRNA cycle factors
    Stress granule specific factors
     302591 (Nxf3)
Ribosome biogenesis [BR:rno03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    302591 (Nxf3)
SSDB
Motif
Pfam: Tap-RNA_bind TAP_C NTF2
Other DBs
NCBI-GeneID: 302591
NCBI-ProteinID: NP_001178660
RGD: 1564923
Ensembl: ENSRNOG00000028751
UniProt: F1M355
Position
X
AA seq 557 aa
MESRSETNPFRRRMRCRRIFRRRFLNSTEYISDTMRTSFYHQQDEELAMSNAPMYTRRRY
TPYGILSHHQRINLHKWDQMNVNMEEGAKPPERKMERDKQDDTSENWFKVTIPFGIKYDK
KWMLNLIQSQCSIPFTPVQFHYEKMQATFFVDDPNIAFMLKAISDKIRDETDNKPQSHIT
PSVILQLTMNQQCDTSQRILNRQRLSFDQDLTTYPTDLVLSPRRYMTPSLNISEEDVTQA
NSEGKMAKEQASDIEEICAVKSSLSTTMPDKSSNINSILELFPKLLSLDGQESCKPALCG
PEDQKTISTYKRSFFESESIKTLVLQFLQQYYFIYDNGDREGLLNAYHADACFSLTVPFS
TMDLSASSVCEYVKYSRSMKVLKDPYMRKQLLKHKKCDIIHFLRALPKTQHDLTSFSVDI
CFQTEKTLCFSVSGLFKEVEGSSQGCFHAFTRIFVATWDNSDLCIINDKLSVRNVYGFPS
ASNAVDTCSSSRLPSLSQDQQQMMPTFCSQSGVNVERSQKCLHDDQWNYNKAIQSFALLK
VKDTVPEDKTTHTSPRS
NT seq 1674 nt   +upstreamnt  +downstreamnt
atggagtccaggtctgaaactaaccccttccgaagaagaatgagatgccgacgtattttc
cgacggagatttctcaactcgactgagtacatcagtgacacgatgcgtacttcattttat
caccagcaagatgaagagctagcaatgagtaatgctcccatgtatactcgaagaagatac
actccatatggcattctgtcccatcatcaaagaatcaatttacataaatgggaccaaatg
aatgttaatatggaggagggcgcaaaacctccagagagaaaaatggagagagacaaacaa
gatgacacttcagagaactggttcaaggtcacaattccctttggcataaaatatgataag
aagtggatgctgaatttgattcagagccagtgcagcatccctttcactccagttcagttt
cactatgaaaaaatgcaggccactttttttgttgatgatcccaacattgcctttatgctg
aaggctatcagtgacaagattcgagatgagactgataataagcctcagagtcacataact
ccatctgtaattctgcagctgactatgaaccaacagtgtgatacttctcagcgcattctt
aataggcagagactctcctttgaccaagatttgacgacctatcctactgacttggtactg
agtcctagaaggtatatgactccttccttgaatatctctgaagaggacgtgacccaggca
aactctgaaggaaagatggccaaggaacaagcctcagacatagaagagatatgtgcagtc
aaaagctctctgagtactaccatgccggataagtccagtaacataaattcaattctggaa
ttgtttcccaagttactaagcctggatggacaggagtcatgtaaaccagctctctgtggc
cctgaagatcaaaagaccatatcaacgtacaagagaagtttttttgaatctgagtccata
aagacactggtcctacagttcctgcagcaatattacttcatctatgacaatggagatcgg
gagggactcctcaatgcttaccacgctgatgcttgcttctcattgaccgtccctttcagt
accatggacttatccgcgagcagcgtgtgtgagtacgtcaagtatagcagaagtatgaag
gttctcaaggatccttatatgcggaagcagctgctaaagcacaagaaatgtgacattatt
cacttccttcgtgcattgcccaaaactcaacatgacttgacctccttctcggtggacata
tgtttccaaacagaaaaaactctctgcttctctgttagtgggttgttcaaggaagtggag
ggcagctctcaagggtgttttcatgccttcactcggatcttcgttgctacctgggacaat
tcagacctttgtatcatcaatgacaagctgtctgtgaggaatgtctatgggtttcccagt
gcctccaacgctgtggacacatgctcctccagccgtttgccttccctctctcaagatcaa
cagcagatgatgccaacattctgttcccagtctggcgtgaatgttgagaggtctcaaaaa
tgccttcatgatgaccagtggaattacaacaaagccatacaaagctttgctttgctcaag
gtaaaggacacggtcccagaggacaagaccacccatacaagtccaagatcctaa

KEGG   Rattus norvegicus (rat): 308653
Entry
308653            CDS       T01003                                 

Gene name
Nxf2
Definition
(RefSeq) nuclear RNA export factor 2 isoform X1
  KO
K14284  nuclear RNA export factor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03008  Ribosome biogenesis in eukaryotes
rno03013  RNA transport
rno03015  mRNA surveillance pathway
rno05014  Amyotrophic lateral sclerosis
rno05164  Influenza A
rno05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    308653 (Nxf2)
   03015 mRNA surveillance pathway
    308653 (Nxf2)
   03008 Ribosome biogenesis in eukaryotes
    308653 (Nxf2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    308653 (Nxf2)
   05168 Herpes simplex virus 1 infection
    308653 (Nxf2)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    308653 (Nxf2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    308653 (Nxf2)
   03009 Ribosome biogenesis [BR:rno03009]
    308653 (Nxf2)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     308653 (Nxf2)
   mRNA cycle factors
    Stress granule specific factors
     308653 (Nxf2)
Ribosome biogenesis [BR:rno03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    308653 (Nxf2)
SSDB
Motif
Pfam: Tap-RNA_bind TAP_C NTF2 LRR_4 LRR_8
Other DBs
NCBI-GeneID: 308653
NCBI-ProteinID: XP_002730329
RGD: 1559530
Ensembl: ENSRNOG00000011729
UniProt: D3Z8R9
Position
X
AA seq 619 aa
MWSSPDKDPEDRPSMIVLKNTNSETQKHRYDLPYKRSETHCHSEYKMSHRRGFQGRKRGA
NYIWHKFDRRNNHFNYPGTPYAVGLKRRKERYSYEDRYFLTVWNDRKTEECEDLYAERRA
TERWYKVTIPSGRKYEKTWLINSIQKLCTVPFVPVDFHYDKNRARFFVQDAKIASALKDV
NLKICDETSRKISLFVSPSVVPYSVQNKFSSEQMEHLKISIMKRYDASQKALDLEKFRFD
QDLMDKDIDMMLNRRSCMVATLQIIESNIPELLSLNLKNNKLYQLDGLSDMTEKAPQVKI
LNLSRNKLKSIFELEKVKELKLEELWLEGNPFCNCYLDDSEYISAVRDLFPKLLRLDGRE
LIVPTGMDIEAPQLCKKTHNETELIKNLVLRFLKEYYLFYDNGDRLRLLDAYHDQACFSL
SVPFNVSDPDLDNLEEYLKYNRDIKKQQDSNMRVQLLKHTKHDIVTSLSLLPKTQHDLCS
FWVDLCFHSEMMLCFSVNGLFKEVEGKCQGCIRAFTRIFIAIPCSDSRICIMNDELIVRN
ASPKEIQKAFTSSPAPDTSLKPLLSAEQQEMVKSFSVQSGMKLDWSQKCLEDNEWDYTKA
GEAFTALQNEGKIPKEFFK
NT seq 1860 nt   +upstreamnt  +downstreamnt
atgtggtcctctccagataaggatccggaagacaggccttccatgattgttctgaagaac
actaattctgagacacaaaaacaccgatatgatctaccatacaagagatctgagacacac
tgtcattcagaatacaaaatgagtcatcgccgtggttttcaaggaagaaagagaggtgca
aattatatctggcataaatttgacaggaggaacaatcattttaattatcctggtactcca
tatgccgtgggactgaaaaggaggaaagaaagatacagttatgaggaccggtattttctt
actgtgtggaatgatagaaaaactgaggagtgtgaggatctgtatgctgaaaggagagcc
acggagagatggtataaggtcacaattccaagtgggagaaagtatgagaagacatggcta
ataaattcaatccagaaactctgtactgtgcccttcgttcctgttgatttccactatgac
aaaaatcgggcccggttctttgttcaggatgccaagattgcctctgcactgaaggatgtc
aacctcaagatttgtgatgaaacaagcagaaaaatttctctctttgtcagtccttctgtt
gtgccctattctgtgcaaaacaagttttcatcagaacaaatggagcatctaaagatatct
ataatgaaacggtatgacgcctcccagaaagctctggacctcgagaagttccgatttgac
caggacttgatggacaaggatattgacatgatgctgaatcgaagaagctgcatggttgcc
acactacagatcattgaaagcaatatccctgaactgttgtccttgaacttgaaaaacaac
aaattgtaccagctggatgggctatctgacatgacagagaaggcccctcaagttaagatt
ctgaacctctccagaaataaactgaagtcaatctttgagttggagaaggtgaaagagctg
aagctggaagagctgtggctagaagggaaccccttctgcaactgctacttggatgattct
gagtatataagtgctgtacgggacctatttcccaagttgttgcgtctggatggcagggag
ttaatagtaccaacaggaatggacatcgaggccccccagctatgcaagaaaacccataac
gaaactgaactcataaaaaatctagttctacgatttctgaaagagtactacttgttttat
gacaatggagatcgtcttcgtctccttgatgcttaccatgaccaggcctgcttctccctg
tccgttcctttcaatgtcagtgacccagacctggacaacttggaagagtatttaaaatat
aacagagatataaagaaacagcaagactcgaacatgcgagtgcagttgctgaagcacaca
aaacatgacatcgtgacctcgcttagcttgttaccaaaaactcagcatgatctttgctct
ttctgggtggacctgtgtttccactcggaaatgatgctctgtttttctgtcaacggactg
ttcaaggaagtggaaggaaaatgtcaaggctgcatccgtgccttcaccaggatcttcatt
gctatcccctgcagcgattcaagaatttgcatcatgaacgatgagttgattgtgaggaat
gccagtcccaaagagatacaaaaggccttcacatcgtcgcctgcacccgacacttctctc
aagcctttactctctgcagagcagcaggaaatggtgaagtctttctctgtgcaatctgga
atgaaacttgattggtctcagaagtgccttgaagataacgaatgggactacaccaaagcg
ggtgaggccttcactgccctccagaatgagggcaaaatcccaaaggaattcttcaaataa

KEGG   Rattus norvegicus (rat): 501621
Entry
501621            CDS       T01003                                 

Gene name
Nxf7
Definition
(RefSeq) nuclear RNA export factor 7
  KO
K14284  nuclear RNA export factor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03008  Ribosome biogenesis in eukaryotes
rno03013  RNA transport
rno03015  mRNA surveillance pathway
rno05014  Amyotrophic lateral sclerosis
rno05164  Influenza A
rno05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    501621 (Nxf7)
   03015 mRNA surveillance pathway
    501621 (Nxf7)
   03008 Ribosome biogenesis in eukaryotes
    501621 (Nxf7)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    501621 (Nxf7)
   05168 Herpes simplex virus 1 infection
    501621 (Nxf7)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    501621 (Nxf7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    501621 (Nxf7)
   03009 Ribosome biogenesis [BR:rno03009]
    501621 (Nxf7)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     501621 (Nxf7)
   mRNA cycle factors
    Stress granule specific factors
     501621 (Nxf7)
Ribosome biogenesis [BR:rno03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    501621 (Nxf7)
SSDB
Motif
Pfam: Tap-RNA_bind TAP_C NTF2 LRR_8 LRR_4
Other DBs
NCBI-GeneID: 501621
NCBI-ProteinID: NP_001032293
RGD: 1566170
Ensembl: ENSRNOG00000023256
UniProt: Q498M8
Position
X
AA seq 614 aa
MCSNERRQGPFRYTGRKKDRVSSLGYTGKKTNHYEDTGHTILPSKAWGNGGNMETRAVLW
NPSVRHTPYSGRRKSREEEHVEDQIHITVWRDEKAQKREVEQFTEDGTLESWFKVTIPCG
RKCDKTQLMNSVHSLCSVPFTPVDFHCDKYRIQFFVQDSSIAYALKDVSYKISSEDFEKI
PIFVNPSVAPYSVQNRFTREQMEQLKLAMKKRYDISQHALCLKKLRFDPDLMNHNIDMIL
NRRSCMTATLQIIQEDFPKLLSLNLSSNKLFQLDSLFDVVKKAPKLKILNLSKNMLRTAW
ELEKIRGLKLEQLWLEGNPLCSTFPDHSSYVSAILEYFPQLSCLDGRKLPLSTGMDIEEP
QLMKPRKAIFKGSEAIKNQVQQFLQDYYLIYDSEERQGLLSIYHEQACFSLTIPFNPSGP
DLSSMCGYFKDERDVKNPKEFHIQRQLLKYTKEDIVGYLRTLPKTLHVFNSFQVDICFQM
EKTLCFSVSGLFKEVEGSSQECIRAFMRIFIAVFESSSNLCIVNDQLFVRNPSPDEIQGA
FAISSPTSCSSFKLVLSQEQQRMVQAFSTQSGMKLEWSQKCLDDNKWDYTRAAEVFTMLQ
TKSKIPKEFFKQMT
NT seq 1845 nt   +upstreamnt  +downstreamnt
atgtgctctaatgaaaggaggcagggaccctttagatacacaggaagaaagaaagacagg
gtttcttctctgggctatactggcaagaagaccaatcattatgaggatactgggcacaca
attctgccttcaaaagcctggggtaatggtggaaatatggagacgagagccgttctctgg
aacccatccgtaagacacacaccttattctggacgacgtaagagcagagaggaagagcat
gtggaggaccaaatccatatcacagtgtggagagatgaaaaagctcaaaagagagaagtg
gagcagttcacagaagacggaacactggagagctggttcaaggtcacgattccatgtggg
agaaagtgtgacaagacacagctaatgaattcagtccacagcctttgcagcgtgcccttc
acaccagtggattttcattgtgacaaataccggatccagttctttgtccaggattctagc
attgcatatgcattgaaggatgtcagctacaagataagtagtgaggactttgagaagata
cctatttttgtcaatccctcagttgcaccctactctgtgcagaataggttcacaagagaa
caaatggagcaactgaagctggccatgaagaaaagatatgatatttcccagcatgctctg
tgcctcaaaaagctccgctttgacccagacttgatgaatcacaacatagacatgattctg
aacagaagaagctgcatgactgccacccttcagatcatccaagaggattttcctaagctg
ttatccttgaacttgagcagcaacaaactgttccagttagatagcctgtttgacgttgta
aagaaggcacccaagctcaagatcctgaacctctccaaaaacatgctaagaacagcatgg
gaactggagaagataagagggctgaagctggaacagctgtggctagaagggaatcccttg
tgcagcaccttcccagaccattcttcttacgtaagtgcaatcctggagtattttccgcag
ttgtcatgcctggatggcaggaagttaccactttcaactggaatggatattgaagaaccc
cagttaatgaagccccgcaaggccatctttaaaggttcggaggccataaagaatcaagtg
cagcaattcctgcaagactattacttgatctatgactctgaagagcgacaaggtctcctg
agcatttaccatgagcaggcctgtttctccctgaccattcccttcaaccccagtggtcca
gatctgagtagcatgtgtgggtacttcaaggatgaaagggatgtgaagaatcccaaggag
ttccacattcagaggcagctgctgaagtacacaaaagaagatattgtgggctatctgagg
acattacccaaaaccctgcatgtcttcaactctttccaggtggacatctgtttccagatg
gaaaaaacgctctgcttctctgttagtgggttgttcaaggaagtggagggcagctctcag
gaatgcatccgtgccttcatgaggatcttcattgctgtctttgaaagtagttcaaacttg
tgcattgtgaatgaccaactttttgtgaggaatccaagccctgatgagatccagggtgcc
tttgctatatcctcgcccacatcatgctccagcttcaagctcgtcctttctcaagagcag
caaagaatggtgcaggctttctccacccagtcggggatgaaacttgaatggtctcagaaa
tgccttgatgacaacaagtgggactatactagagctgctgaagtcttcactatgctccag
accaagagtaagatcccgaaggaattcttcaaacaaatgacttaa

KEGG   Rattus norvegicus (rat): 59087
Entry
59087             CDS       T01003                                 

Gene name
Nxf1
Definition
(RefSeq) nuclear RNA export factor 1
  KO
K14284  nuclear RNA export factor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03008  Ribosome biogenesis in eukaryotes
rno03013  RNA transport
rno03015  mRNA surveillance pathway
rno05014  Amyotrophic lateral sclerosis
rno05164  Influenza A
rno05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    59087 (Nxf1)
   03015 mRNA surveillance pathway
    59087 (Nxf1)
   03008 Ribosome biogenesis in eukaryotes
    59087 (Nxf1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    59087 (Nxf1)
   05168 Herpes simplex virus 1 infection
    59087 (Nxf1)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    59087 (Nxf1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    59087 (Nxf1)
   03009 Ribosome biogenesis [BR:rno03009]
    59087 (Nxf1)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     59087 (Nxf1)
   mRNA cycle factors
    Stress granule specific factors
     59087 (Nxf1)
Ribosome biogenesis [BR:rno03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    59087 (Nxf1)
SSDB
Motif
Pfam: Tap-RNA_bind NTF2 TAP_C LRR_8 LRR_4 LRR_9
Other DBs
NCBI-GeneID: 59087
NCBI-ProteinID: NP_067590
RGD: 62014
Ensembl: ENSRNOG00000019069
UniProt: O88984
Position
1
AA seq 618 aa
MADEGKSYNEHDDRVSFPQRRKKGRGPFRWKCGEGNRRSGRGGSGIRSSRFEEDDGDVAM
NDPQDGPRVRYNPYTSRPNRRRDTWHDRDRIHVTVRRDRAPQERGGAGTSQDGTTKNWFK
ITIPYGKKYDKMWLLSMIQSKCSVPFNPIEFHYENTRAQFFVEDATTASALKAVNYKIQD
RENRRISIIINSSAPPYIVQNELKPEQVEQLKLIMSKRYDGSQQALDLKGLRSDPDLVAQ
NIDVVLNRRGCMAAALRIIEENIPELLSLNLSNNRLYKLDDMSSIVQKAPNLKILNLSGN
ELKSEWELDKIKGLKLEELWLDRNPMCDTFLDQSTYISTIRERFPKLLRLDGHELPPPIA
FDVEAPTMLPPCKGSYFGTENLKSLVLHFLQQYYAIYDSGDRQGLLDAYHDGACCSLSTP
SNPQNPVRHNLAKYFNDSRNVKKIKDTTTRFRLLKHTRLNVVAFLNELPKTHHDVNSFVV
DISAQTSTLLCFSVNGVFKEVDGKSRDSLRAFTRTFIAVPASNSGLCIVNDELFVRNASP
EEIQRAFAMPAPTPSSSPVPTLSQEQQDMLQAFSTQSGMNLEWSQKCLQDNNWDYTRSAQ
AFTHLKAKGEIPEVAFMK
NT seq 1857 nt   +upstreamnt  +downstreamnt
atggcggacgaagggaagtcatacaacgaacatgatgaccgtgttagtttcccacaaaga
agaaagaaaggtcgggggcctttccgatggaagtgtggtgaggggaatcgtaggtctgga
agaggtggttctggtatacggtcttcccggtttgaggaagatgatggagatgtggcaatg
aatgatccccaggatggcccccgagtgagatacaacccctataccagccgacctaaccgt
cggagagatacttggcatgatcgagatcggattcatgttactgtacggagagacagagct
cctcaagaaagaggaggtgctggcaccagtcaagatgggaccaccaagaactggttcaag
attacaattccttatggcaaaaagtatgataaaatgtggcttctgagcatgattcagagc
aagtgcagtgtccccttcaaccccattgagtttcactatgaaaatacacgggcccagttt
tttgtggaagatgccactaccgcttctgcattaaaggctgtcaactataagattcaggat
cgagaaaacagaaggatatctatcatcatcaactcttctgctccaccctatattgtacag
aatgaactgaagcctgaacaagtagagcagctcaagctgatcatgagcaaacgatatgat
ggctcccagcaagcacttgacctcaagggcctccgctcagacccagatttggtggcccag
aacatcgatgttgttctaaaccgtagaggctgtatggcagccgccctgaggatcattgaa
gagaacattcctgagctattgtctttgaacttgagtaacaacaggctgtacaagcttgat
gacatgtccagcattgtacagaaggcaccaaacttaaagatcctgaatctctctggaaac
gaattgaagtccgagtgggaattagacaagataaaagggctgaagctggaagagctgtgg
cttgacagaaaccccatgtgtgacaccttcctagaccagtccacctatatcagcaccatt
cgcgaacgatttcccaagttattacgcctggatggccatgagctaccccctccaattgcc
tttgatgtcgaagcccctactatgttaccaccctgcaagggaagctattttggaacagag
aacctaaagagtctggtcctgcacttcttgcagcagtactatgcaatttatgactcagga
gaccgccagggtcttctggatgcctaccatgatggcgcctgttgctcgctaagcactcct
tccaaccctcagaaccctgtccgacacaacttagccaaatacttcaatgacagcagaaat
gtgaagaagattaaagataccaccacgcggttccggctattaaagcatacacgtcttaat
gtcgttgccttcctcaatgagttacctaaaactcaccatgacgttaactcctttgtggta
gatataagtgcccaaacaagcacattgttgtgtttttctgtcaatggagtcttcaaggaa
gtggacgggaagtctcgagattctttacgtgctttcacgagaacgttcattgctgttcct
gccagcaattcagggctatgtattgtaaatgacgaattatttgtgcggaacgccagccct
gaagaaatccaaagagccttcgccatgcctgcacccacaccttcttccagcccagtaccc
acactctcccaagaacagcaggatatgttacaagcattttctacccagtctggcatgaac
ctcgagtggtctcagaagtgccttcaagacaataactgggactacaccagatctgcccag
gccttcactcatctcaaggccaagggagagattccagaagtagcgtttatgaaatga

KEGG   Rattus norvegicus (rat): 680025
Entry
680025            CDS       T01003                                 

Gene name
Nxf5
Definition
(RefSeq) nuclear RNA export factor 2-like
  KO
K14284  nuclear RNA export factor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03008  Ribosome biogenesis in eukaryotes
rno03013  RNA transport
rno03015  mRNA surveillance pathway
rno05014  Amyotrophic lateral sclerosis
rno05164  Influenza A
rno05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    680025 (Nxf5)
   03015 mRNA surveillance pathway
    680025 (Nxf5)
   03008 Ribosome biogenesis in eukaryotes
    680025 (Nxf5)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    680025 (Nxf5)
   05168 Herpes simplex virus 1 infection
    680025 (Nxf5)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    680025 (Nxf5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    680025 (Nxf5)
   03009 Ribosome biogenesis [BR:rno03009]
    680025 (Nxf5)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     680025 (Nxf5)
   mRNA cycle factors
    Stress granule specific factors
     680025 (Nxf5)
Ribosome biogenesis [BR:rno03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    680025 (Nxf5)
SSDB
Motif
Pfam: Tap-RNA_bind NTF2 LRR_8 DUF1439 LRR_4
Other DBs
NCBI-GeneID: 680025
NCBI-ProteinID: XP_038956086
RGD: 1596862
Position
X
AA seq 621 aa
MSSFQEVSGNKNLYDEFHLDTVLPPQLQDNDGNMQIMDANGDPQMLYEQQLKSSLESLES
SYTFSVKEDCGTTYSACQEKTLSDEEMNRSILGEVFERWFKITIPNGKKYNKMWLINLLQ
SYCSMGFTPVDFQYIRNGIQFFVQSTKTAVELMNINYQISDEENKKISIYVNSSSEPASV
HYKLTAAQMHSLKLSMKKRYDVSKKALYLGKLRFDQDLMDHGIDMFLNRRSCMTAALQII
QENFPELLSLNVSNNKIYWLDGLSELIEKAPHVKTLNLSRNLLRTAWELEKIRGLNLEQL
WLEGNPLCSTFPDHSSYVSAILNYFPELSHLPTGFPAPFHTCLLFLFQSLLYLLGHHMSC
PPSVPLISYFLQDGRKLFPTIDINTLEIIKPRKESYKGSECLKNLLVQFMLQYYLIYDYG
DRHSLLNAYHANACFSLAITFNSDKADMSSLEDYLKDNRNMKMLTNSFLRMQLLKHKKYN
IVTCLHELPKTQHDLNSYVVDICVQTEKMICFSVNGVFKEVEGKSWGSVRAFTRTFILTP
DRHFRLCIVNDEMILRNANPAEARKAFSTTRPTVSYTQSCWNTHTDLKYCKNKWKCIRED
EALFTFQSEERSSSEFFRYKF
NT seq 1866 nt   +upstreamnt  +downstreamnt
atgagttctttccaagaagtttctggaaacaagaacctttatgatgaatttcatctggac
acagttttaccaccacaactccaggacaatgatggaaacatgcagataatggacgccaat
ggggaccctcaaatgttatatgagcagcaattgaagtcctccttggagagcctagagagc
tcttataccttcagtgtcaaagaagattgtggtacaacatattcagcatgccaagagaaa
actctttctgatgaagaaatgaacagaagcatactgggtgaagtctttgagaggtggttc
aagatcacgattccaaatgggaaaaagtacaacaagatgtggttaataaatttactccag
agttattgcagtatgggcttcacaccagttgatttccagtacatcagaaacggtatccaa
ttctttgttcaaagtaccaaaactgctgttgaactgatgaatataaactaccagataagt
gacgaggagaacaaaaagatttctatctatgtgaattcatctagtgagcctgcatctgta
cactataagttaacagcagcacaaatgcacagcctaaagctgagcatgaagaaacgatat
gatgtctctaagaaagctctgtacctcggaaagcttcgctttgaccaagacttgatggat
catggaattgacatgtttctgaacagaagaagctgcatgactgctgcccttcaaatcatc
caagagaatttccccgagctgttgtccttgaacgtgagcaacaacaaaatatactggcta
gatggcctgtcggaattaatagagaaagcccctcacgtcaagactctcaacctttcaaga
aatttgctaagaacagcatgggaactggagaagataagagggctgaatctggaacagctg
tggctagaagggaatcccttgtgcagcaccttcccagaccattcttcttacgtaagtgcg
attctgaactattttccggagttgtcacacttacccacgggatttcctgcgccatttcac
acctgtctcttattcttgttccaaagccttctttacctccttgggcatcatatgtcatgt
cccccatctgtgcccctaatatcttacttcctgcaggatggcaggaaattattcccaaca
attgacattaacaccttggaaataataaaaccacgcaaggaaagctacaaaggatctgag
tgtctgaagaatctgctcgtgcaatttatgcttcagtattacttgatctatgactatggt
gatcgacacagtctcctaaacgcttaccatgcaaatgcctgcttctccctggccatcact
ttcaactccgataaggcagacatgagcagcttagaagactacctcaaagataataggaat
atgaagatgctgacgaactcctttttgcggatgcagctgctgaagcacaaaaaatataac
atcgtgacctgcctccatgaactgccaaaaacacagcatgatttaaattcctatgtagta
gacatttgtgtccagacagaaaaaatgatctgcttctctgtcaatggagtattcaaggaa
gtggaaggaaagtcttggggaagtgttcgggccttcacccggacattcatcttaactcct
gacaggcatttcagactgtgcattgtgaatgatgagatgattttgaggaatgccaaccct
gcagaggcaaggaaggccttctctaccactaggcccacagtatcctacacccagagttgc
tggaacacccacactgatctaaagtattgtaagaacaagtggaaatgcatcagagaggat
gaagccctctttacattccagagtgaggaaagatcctcaagtgaattcttcagatacaag
ttctga

DBGET integrated database retrieval system