KEGG   Rattus norvegicus (rat): 302668
Entry
302668            CDS       T01003                                 

Gene name
Ace2
Definition
(RefSeq) angiotensin I converting enzyme 2
  KO
K09708  angiotensin-converting enzyme 2 [EC:3.4.17.23]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04614  Renin-angiotensin system
rno04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04614 Renin-angiotensin system
    302668 (Ace2)
  09154 Digestive system
   04974 Protein digestion and absorption
    302668 (Ace2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    302668 (Ace2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    302668 (Ace2)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.23  angiotensin-converting enzyme 2
     302668 (Ace2)
Peptidases and inhibitors [BR:rno01002]
 Metallo peptidases
  Family M2
   302668 (Ace2)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   302668 (Ace2)
SSDB
Motif
Pfam: Peptidase_M2 Collectrin Peptidase_M32 DUF4407 Glycophorin_A
Other DBs
NCBI-GeneID: 302668
NCBI-ProteinID: NP_001012006
RGD: 728890
Ensembl: ENSRNOG00000031665
UniProt: Q5EGZ1 C7ECU5
Position
Xq14
AA seq 805 aa
MSSSCWLLLSLVAVATAQSLIEEKAESFLNKFNQEAEDLSYQSSLASWNYNTNITEENAQ
KMNEAAAKWSAFYEEQSKIAQNFSLQEIQNATIKRQLKALQQSGSSALSPDKNKQLNTIL
NTMSTIYSTGKVCNSMNPQECFLLEPGLDEIMATSTDYNRRLWAWEGWRAEVGKQLRPLY
EEYVVLKNEMARANNYEDYGDYWRGDYEAEGVEGYNYNRNQLIEDVENTFKEIKPLYEQL
HAYVRTKLMEVYPSYISPTGCLPAHLLGDMWGRFWTNLYPLTTPFLQKPNIDVTDAMVNQ
SWDAERIFKEAEKFFVSVGLPQMTPGFWTNSMLTEPGDDRKVVCHPTAWDLGHGDFRIKM
CTKVTMDNFLTAHHEMGHIQYDMAYAKQPFLLRNGANEGFHEAVGEIMSLSAATPKHLKS
IGLLPSNFQEDNETEINFLLKQALTIVGTLPFTYMLEKWRWMVFQDKIPREQWTKKWWEM
KREIVGVVEPLPHDETYCDPASLFHVSNDYSFIRYYTRTIYQFQFQEALCQAAKHDGPLH
KCDISNSTEAGQKLLNMLSLGNSGPWTLALENVVGSRNMDVKPLLNYFQPLFVWLKEQNR
NSTVGWSTDWSPYADQSIKVRISLKSALGKNAYEWTDNEMYLFRSSVAYAMREYFSREKN
QTVPFGEADVWVSDLKPRVSFNFFVTSPKNVSDIIPRSEVEEAIRMSRGRINDIFGLNDN
SLEFLGIYPTLKPPYEPPVTIWLIIFGVVMGTVVVGIVILIVTGIKGRKKKNETKREENP
YDSMDIGKGESNAGFQNSDDAQTSF
NT seq 2418 nt   +upstreamnt  +downstreamnt
atgtcaagctcctgctggctccttctcagccttgttgctgttgctactgctcagtccctc
atcgaggaaaaggccgagagctttttaaacaagtttaaccaggaagctgaagacctgtct
tatcaaagttcacttgcttcttggaattacaacaccaacattacggaggagaatgcccaa
aagatgaacgaggctgcggccaaatggtctgccttttatgaagaacagtccaagatcgcc
caaaatttctcactacaagaaattcagaatgcgaccatcaagcgtcaactgaaggccctt
cagcagagcgggtcttcagcgctgtcaccagacaagaacaaacagttgaacacaattcta
aacaccatgagcaccatttacagtactggaaaagtttgcaactcaatgaatccacaagaa
tgttttttacttgaaccaggattggacgaaataatggcaacaagcacagactacaatcgt
aggctctgggcttgggagggctggagggctgaggtcggcaagcagctgaggccgttatat
gaagagtatgtggtcctgaaaaatgagatggcaagagcaaacaattatgaagactatggg
gattattggcgaggggattatgaagcagagggagtagaaggttacaactacaaccgaaac
cagttgatcgaagacgtagaaaataccttcaaagagatcaaaccgttgtatgagcaactt
catgcctatgtgagaacgaagttgatggaagtgtacccttcttacatcagccctactgga
tgcctccctgctcatttgcttggtgatatgtggggtaggttttggacaaatctgtaccct
ttgactactccctttcttcagaaaccaaacatagatgttactgatgcaatggtgaatcag
agctgggatgcagaaagaatatttaaagaggcagagaagttcttcgtttctgttggcctt
cctcaaatgactccgggattctggacaaactccatgctgactgagccaggagatgaccgg
aaagttgtctgccaccccacagcttgggatctgggacatggagacttcagaatcaagatg
tgcacaaaggtcacaatggacaacttcttgacagcccatcatgagatgggacacatccaa
tatgacatggcatatgccaagcaacctttcctgctaagaaacggagccaatgaagggttc
catgaagccgttggagaaatcatgtcactttctgcagctacccccaaacatttgaaatct
attggtcttctgccatccaattttcaagaagacaatgaaacagaaataaacttcctactc
aaacaggcattgacaattgttggaacgctgccatttacttacatgttagagaagtggagg
tggatggtctttcaggataaaattcccagagaacagtggaccaaaaagtggtgggagatg
aagcgggagatcgttggtgtggtggagcctctgcctcatgatgaaacatactgtgaccct
gcatctctgttccatgtctctaatgattactcattcattcgatattacacaaggaccatt
tatcaattccagtttcaagaagctctttgtcaagcagctaaacatgatggcccactacac
aaatgtgacatctcaaattccactgaagctgggcagaagttgctcaatatgctgagtctt
ggaaactcagggccctggaccctagccttggaaaatgtggtaggatcaaggaatatggat
gtaaaaccactgctcaattacttccaaccattgtttgtctggctgaaagagcagaacagg
aattcgactgtggggtggagcactgactggagcccatatgccgaccaaagcattaaagtg
aggataagcctaaaatcagctcttgggaaaaatgcgtatgaatggaccgacaacgaaatg
tacctattccgatcatctgttgcctatgccatgagagagtatttttcaagggaaaagaac
cagacagttccttttggggaggcagacgtatgggtgagtgatttgaaaccaagagtctcc
ttcaacttctttgtcacttcacccaaaaatgtgtctgacatcattcccagaagtgaagtt
gaagaggccatcaggatgtctcggggccgtatcaatgatatttttggtctgaatgataac
agcctggagtttctggggatctacccaacacttaagccaccttacgagcctcctgtcacc
atatggctgattatttttggtgtcgtgatgggaacggtagtggttggcattgttatcctg
atcgtcactgggatcaaaggtcgaaagaagaaaaatgaaacaaaaagagaagagaatcct
tatgactccatggacattggcaaaggagaaagtaacgcaggattccaaaacagtgatgat
gctcaaacttcattctaa

DBGET integrated database retrieval system