KEGG   Rattus norvegicus (rat): 302669Help
Entry
302669            CDS       T01003                                 

Gene name
Ca5b, Car5b
Definition
(RefSeq) carbonic anhydrase 5B
  KO
K01672  carbonic anhydrase [EC:4.2.1.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00910  Nitrogen metabolism
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    302669 (Ca5b)
Enzymes [BR:rno01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.1  carbonic anhydrase
     302669 (Ca5b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carb_anhydrase Tudor_3
Motif
Other DBs
NCBI-GeneID: 302669
NCBI-ProteinID: NP_001005551
RGD: 1549783
Ensembl: ENSRNOG00000029330
UniProt: Q66HG6
Position
Xq14
AA seq 317 aa AA seqDB search
MTVMSHLRVSLQVSSCTLLWRRFRVPRLVPLRSCSLYTCTYRTRNRALPPLWENLDLVPA
GDRQSPINIRWRDSVYDPGLKPLTISYDPATCLHIWNNGYSFLVEFEDTTDKSVIEGGPL
EHNYRLKQFHFHWGAIDAWGSEHTVDSKCYPAELHLVHWNAVKFESFEDAALEENGLAVI
GVFLKLGKHHKELQKLVDTLPSIKHKDTLVKFGSFDPSCLMPTCPDYWTYSGSLTTPPLS
ESVTWIIKKQPVEVDHDQLEQFRTLLFTSEGEKEKRMVDNFRPLQPLMNRTVRSSFRHDY
VLNIQVKPEPTASEVSP
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgacagtgatgagtcacctgagagtgagtctacaagtctcttcgtgcacgctgctgtgg
agacggttccgggttccgaggttggtgccactgaggtcctgcagtctgtatacctgcaca
tacagaaccaggaatcgagccttacctccactctgggagaacttggaccttgttcctgct
ggtgatcggcagtcacccatcaacatccgatggagggacagtgtttatgaccctggctta
aaaccactcaccatttcttatgacccagccacctgcctccacatctggaacaatgggtac
tcctttcttgtggaatttgaagatactacagataaatcagtaattgagggaggacccctg
gaacataactaccgactgaagcagtttcattttcactggggggccatcgacgcttggggc
tccgagcacactgtggacagcaaatgctacccagcagagctgcacttggtacattggaat
gcagtcaaatttgaaagttttgaggatgcagcactggaagaaaatggcttggctgtgata
ggtgtatttttaaagctaggtaaacatcataaagaactgcagaaattggtggacactttg
ccatcaattaagcacaaggataccctggtgaaatttggatcatttgacccttcctgtctg
atgcctacttgcccagattactggacctattctggatctctcactacgcctcccctctca
gagtctgttacctggatcattaagaagcagccagttgaggtcgaccatgatcagcttgaa
cagtttcggaccctgcttttcacatctgagggagagaaagagaaaagaatggtggacaac
ttccgcccacttcaacctctgatgaatcgcactgtccgttcatccttccgccatgactat
gtgctcaatatacaagtgaagcccgagccgactgccagcgaagtctccccctaa

DBGET integrated database retrieval system