KEGG   Rattus norvegicus (rat): 302671
Entry
302671            CDS       T01003                                 

Gene name
Ap1s2, RGD1561862
Definition
(RefSeq) adaptor-related protein complex 1, sigma 2 subunit
  KO
K12394  AP-1 complex subunit sigma 1/2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
rno05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    302671 (Ap1s2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    302671 (Ap1s2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    302671 (Ap1s2)
Membrane trafficking [BR:rno04131]
 Endosome - Golgi transport
  Others
   AP-1 complex
    302671 (Ap1s2)
SSDB
Motif
Pfam: Clat_adaptor_s PulA_N1
Other DBs
NCBI-GeneID: 302671
NCBI-ProteinID: NP_001121003
RGD: 1561862
Ensembl: ENSRNOG00000038686
UniProt: B2GV08
Position
Xq14
AA seq 157 aa
MQFMLLFSRQGKLRLQKWYVPLSDKEKKKITRELVQTVLARKPKMCSFLEWRDLKIVYKR
YASLYFCCAIEDQDNELITLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLLGG
EVQETSKKNVLKAIEQADLLQEEAETPRSVLEEIGLT
NT seq 474 nt   +upstreamnt  +downstreamnt
atgcagtttatgttgctttttagtcgtcagggaaagcttcgactgcagaaatggtatgtc
ccactgtcagacaaagagaagaagaaaatcaccagagaacttgtgcaaaccgttttagca
cggaaacccaagatgtgcagcttccttgagtggagagatctgaagattgtttataaaaga
tatgccagtctatatttttgctgtgctattgaggatcaggacaatgaactgattaccctg
gaaataatccatcgttatgtggaattacttgacaagtattttggcagtgtgtgtgaactt
gatatcatctttaattttgagaaggcctattttattttggatgaatttcttttgggagga
gaagttcaggaaacatcaaagaaaaatgtccttaaagcaattgagcaggctgatctcctg
caggaggaagctgaaaccccacgtagtgttcttgaagaaattggactgacataa

DBGET integrated database retrieval system