KEGG   Rattus norvegicus (rat): 302697
Entry
302697            CDS       T01003                                 

Gene name
Eif1ax
Definition
(RefSeq) eukaryotic translation initiation factor 1A, X-chromosomal
  KO
K03236  translation initiation factor 1A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03013  RNA transport
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    302697 (Eif1ax)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:rno03012]
    302697 (Eif1ax)
Translation factors [BR:rno03012]
 Eukaryotic type
  Initiation factors
   eIF-1
    302697 (Eif1ax)
SSDB
Motif
Pfam: eIF-1a
Other DBs
NCBI-GeneID: 302697
NCBI-ProteinID: NP_001100433
RGD: 1560198
Ensembl: ENSRNOG00000005736
UniProt: B5DF60
Position
X
AA seq 144 aa
MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCH
IRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDT
FGPGDDDEIQFDDIGDDDEDIDDI
NT seq 435 nt   +upstreamnt  +downstreamnt
atgcccaagaataaaggaaaaggaggtaaaaaccggcgtagagggaagaatgaaaatgaa
tccgaaaagcgagagcttgtgttcaaggaggatgggcaagaatatgctcaggtaatcaaa
atgttgggaaatggacgattggaagccatgtgtttcgatggtgtaaagaggctttgccac
atcagaggaaaattgagaaaaaaggtttggataaatacctcggatatcatattggtgggc
ctccgagattaccaggacaacaaagccgatgtcattttaaaatacaacgcagatgaagct
agaagtctcaaggcctatggcgagcttccggaacatgctaaaatcaatgaaactgataca
tttggtcctggagatgatgatgaaattcagtttgatgacattggggatgatgatgaagac
atcgatgatatctaa

DBGET integrated database retrieval system