KEGG   Rattus norvegicus (rat): 302813Help
Entry
302813            CDS       T01003                                 

Gene name
Gpr119
Definition
(RefSeq) G protein-coupled receptor 119
  KO
K08424  glucose-dependent insulinotropic receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04024  cAMP signaling pathway
rno04911  Insulin secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    302813 (Gpr119)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    302813 (Gpr119)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    302813 (Gpr119)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Lipid
   Oleoylethanolamide
    302813 (Gpr119)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7tm_4
Motif
Other DBs
NCBI-GeneID: 302813
NCBI-ProteinID: NP_861435
RGD: 727808
Ensembl: ENSRNOG00000024517
UniProt: Q7TQN8
Position
Xq36
AA seq 468 aa AA seqDB search
MESSFSFGVILAVLTILIIAVNALVVVAMLLSIYKNDGVGLCFTLNLAVADTLIGVAISG
LVTDQLSSSAQHTQKTLCSLRMAFVTSSAAASVLTVMLIAFDRYLAIKQPLRYFQIMNGL
VAGGCIAGLWLISYLIGFLPLGVSIFQQTTYHGPCTFFAVFHPRFVLTLSCAGFFPAVLL
FVFFYCDMLKIASVHSQHIRKMEHAGAMVGACRPPRPVNDFKAVRTVSVLIGSFTLSWSP
FLITSIVQVACHKCCLYQVLEKYLWLLGVGNSLLNPLIYAYWQREVRQQLCHMALGLLAD
GSTQPQIETLKGKEERKKVGRKTLYTCDAQTLYTCDAQTLYTCDAQTLYTCDACDTQTLY
TCDAQTLYTCDAQTLYTCDAQTLYTCDAQTLYTCDAQTLYTCDTQTLYTCDAQTLYTCDA
QTLYTCDAQTLYTCDAQTLYTSSLVTGQTEQTPLKRANMSDPLRTCRG
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atggagtcatctttctcatttggagtgatccttgctgtcctgaccatccttatcattgct
gttaatgcgctggtggttgtggctatgctgctatcaatctacaagaatgatggtgttggc
ctttgcttcaccttaaatctggccgtggctgataccttgattggcgtggctatttctggg
ctagttacagaccagctctccagctctgctcagcacacacagaagaccttgtgtagcctt
cggatggcattcgtcacttcttctgcagccgcctctgtcctcacggtcatgctgattgcc
tttgacaggtacctggccattaagcagcccctccgttacttccagatcatgaatgggctt
gtagccggaggatgcattgcagggctgtggttgatatcttaccttatcggcttcctccca
cttggagtctccatattccagcagaccacctaccatgggccctgcaccttctttgctgtg
tttcacccaaggtttgtgctgaccctctcctgtgctggcttcttcccagctgtgctcctc
tttgtcttcttctactgtgacatgctcaagattgcctctgtgcacagccagcacatccgg
aagatggaacatgcaggagccatggttggagcttgccggcccccacggcctgtcaatgac
ttcaaggctgtccggactgtatctgtccttattgggagcttcaccctgtcctggtctccg
tttctcatcactagcattgtgcaggtggcctgccacaaatgctgcctctaccaagtgctg
gaaaaatacctctggctccttggagttggcaactccctgctcaacccactcatctatgcc
tattggcagagggaggttcggcagcagctctgccacatggccctggggctacttgctgat
ggcagtacacaaccccaaattgagacactgaaagggaaggaagagagaaagaaggtagga
agaaagacgctgtacacatgtgatgcacagacgctgtacacatgtgatgcacagacgctg
tacacatgtgatgcacagacgctgtacacatgtgatgcatgtgatacacagacactgtac
acatgtgatgcacagacgctgtacacatgtgatgcacagacgctgtacacatgtgatgca
cagacgctgtacacatgtgatgcacagacgctgtacacatgtgatgcacagacactgtac
acatgtgatacacagacgctgtacacatgtgatgcacagacgctgtacacatgtgatgca
cagacgctgtacacatgtgatgcacagacgctgtacacatgtgatgcacagacgctgtac
acatcaagtttggtaactggccaaactgagcagacaccactgaaacgagcaaacatgagt
gatcctctgaggacatgcaggggataa

DBGET integrated database retrieval system