KEGG   Rattus norvegicus (rat): 302817Help
Entry
302817            CDS       T01003                                 

Gene name
Enox2, Cova1, RGD1563643
Definition
(RefSeq) ecto-NOX disulfide-thiol exchanger 2
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 RRM_7 Nup35_RRM_2 Mobilization_B
Motif
Other DBs
NCBI-GeneID: 302817
NCBI-ProteinID: XP_002727715
RGD: 1563643
Ensembl: ENSRNOG00000030622
UniProt: A0A1W2Q6I1
Position
Xq36
AA seq 582 aa AA seqDB search
MTLPVSDPTAWATAMNNLGMAPLGIAGQPILPEFDPALGMMTGIPPITPMMPGLGIVPPP
IPPDMPVVKEIIHCKSCTLFPPNPNLPPPATRERPPGCKTVFVGGLPENGTEQIIVEVFE
QCGEIIAIRKSKKNFCHIRFAEEYMVDKALYLSGYRIRLGSSTDKKDTGRLHVDFAQARD
DLYEWECKQRMLAREERHRRRMEEERMRPPSPPPVVHYSDHECSIVAEKLKDDSKFSEAV
QTLLTWIERGEVNRRSANHFYSMIQSANSHVRRLVNEKAAHEKEMEEAKEKFKQALSGIL
IQFEQIVAVYHSASKQKAWDHFTKAQRKNISVWCKQAEEIRNIHNDELMGIRREEEMEMS
DDEIEETTETKETEESALVSQAEALKEENDSLRWQLDAYRNEVELLKQEQGKAHREDDPN
KEQQLKLLQQALQGMQQHLLKVQEEYKKKEAELDRIKDDKLQVEKLLENLHEKQENCTSR
LCASSQESDHPLEKAIIGNPVKSEREALLVGIISTFLHVHPFGASIEYICSYLNRLDNKI
CTSDVESLMSRLQHTFRQEMTGVGASLEKRWKFCGFEGLKLT
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgacgctacctgtatctgatccaactgcatgggccacagcaatgaataatcttggaatg
gcgcctctgggaattgctggacaaccaattttacctgaatttgatcccgcccttggaatg
atgactggaataccaccaataactccaatgatgcctggtttgggaatagtacctccacca
attcctccagatatgcctgtagtaaaggagatcatacactgcaaaagctgcacgctcttc
cctcccaacccaaatctcccgccacctgcaacacgagaaagaccaccaggctgtaagact
gtatttgtgggtggcctgcctgaaaatgggacagagcagatcattgtggaagtgtttgag
cagtgtggagagatcattgctatccggaagagcaaaaagaacttctgtcacattcgcttt
gctgaggagtacatggtggacaaagccctctatctgtctggttacagaattcgcctgggc
tctagtactgacaagaaggacacaggccggctccatgttgactttgcccaggctcgggat
gacttatacgaatgggagtgtaaacagcgtatgctagcaagagaggagcggcaccgtaga
cggatggaagaagaaagaatgcgtccaccatccccacccccagtggtccactattcagat
catgaatgcagcattgttgctgaaaaactaaaagatgattccaaattctcagaagctgtg
cagactttgctcacctggatagagaggggggaggtgaaccgccgcagtgccaaccacttc
tactcgatgatccagtcagccaacagccatgtccgccgactagtgaatgagaaagctgcc
cacgaaaaagaaatggaggaagcaaaagagaagttcaagcaggccctttctggaattctc
attcagtttgagcagatagtagctgtgtaccattccgcttccaaacagaaggcatgggac
cacttcacaaaagcacaacgtaaaaacatcagcgtttggtgcaaacaagctgaggaaatt
cgcaacattcataatgatgaattaatgggaatcaggagagaagaagaaatggaaatgtct
gatgatgaaatagaagagacaacagaaacaaaagaaacagaagaatcagccttagtgtca
caggctgaagctctgaaggaggaaaacgatagcctccgttggcagctggatgcctaccgg
aatgaggtagaactgctcaagcaggaacaaggcaaggctcacagggaggatgacccaaac
aaggagcagcagctgaaacttctgcagcaagccctacaggggatgcagcagcatctgctc
aaagtccaagaggaatacaaaaagaaagaagctgaacttgacagaatcaaagacgacaag
ttacaggtggaaaaactgttggaaaatcttcatgaaaagcaggaaaactgtacttcaaga
ctgtgtgcatcaagccaagaaagtgaccaccctcttgagaaggccataatcggcaaccct
gtcaaatcggaacgtgaggcactgctagtggggatcatctccacattccttcacgtgcac
ccatttggagcaagcattgaatacatctgttcctacttgaatcgtcttgataataagatc
tgcaccagtgatgtggaatctctcatgagtagactccaacataccttcaggcaggaaatg
accggagttggagccagcctagagaagagatggaaattctgtggttttgaaggcttgaag
ctgacctga

DBGET integrated database retrieval system