KEGG   Rattus norvegicus (rat): 302938
Entry
302938            CDS       T01003                                 

Gene name
Mgrn1, RGD1311862
Definition
(RefSeq) mahogunin ring finger 1
  KO
K10604  E3 ubiquitin-protein ligase MGRN1 [EC:2.3.2.27]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04120  Ubiquitin mediated proteolysis
rno04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    302938 (Mgrn1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    302938 (Mgrn1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    302938 (Mgrn1)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     302938 (Mgrn1)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    302938 (Mgrn1)
SSDB
Motif
Pfam: zf-C3HC4_3 Prok-RING_4 zf-RING_2 zf-RING_5 zf-C3HC4_2 zf-RING_11
Other DBs
NCBI-GeneID: 302938
NCBI-ProteinID: NP_001013986
RGD: 1311862
Ensembl: ENSRNOG00000003234
UniProt: Q5XIQ4
Position
10q12
AA seq 533 aa
MGSILSRRIAGVEDIDIQANSAYRYPPKSAGNYFASHFFMGGEKFDTPHPEGYLFGENMD
LNFLGSRPVQFPYVTPAPHEPVKTLRSLVNIRKDSLRLVRYKDDTDSPTEDGEKPRVLYS
LEFTFDADARVAITIYCQAVEEFVNGMTVYSCKNPSLQSETVHYKRGVSQQFSLPSFKID
FSEWKDDELNFDLDRGVFPVVIQAVVDEGDVVEVTGHAHVLLAAFEKHVDGSFSVKPLKQ
KQIVDRVSYLLQEIYGIENKNNQETKPSDDENSDNSSECVVCLSDLRDTLILPCRHLCLC
TSCADTLRYQANNCPICRLPFRALLQIRAVRKKPGALSPISFSPVLAQSVDHDEHSNSDS
VPPGYEPISLLEALNGLRAVSPAIPSAPLYEEITYSGISDGLSQASCPLAGLDRIIENGI
QKGKTQSKSPDSTLRSPSSPIHEEDEEKLSEDPEAPLPPSGVELVLQESSSPESFGTEEV
GEPSLKQGSRVPSIDDVLQDGSPQHHGCSQPVPPADIYLPALGPESCSVGIEE
NT seq 1602 nt   +upstreamnt  +downstreamnt
atgggctccatcctgagtcgccgcatcgcgggcgtggaggacatcgacattcaggccaac
tcggcctatcgttaccctccgaagtccgcaggaaactactttgcttcgcactttttcatg
ggaggagagaagtttgacactccccatcctgaaggttacctctttggcgagaacatggac
ctgaacttcctgggtagtcgtccagtccagttcccctatgtcacccctgccccccatgag
ccagtgaagacactcaggagcctggtaaacattcgcaaagactctctccggctggtgagg
tacaaagatgacacagacagccccacagaggacggcgagaagccccgcgtgctctacagt
ctggaattcacctttgatgctgatgcccgtgtggctatcaccatttattgccaggcagtg
gaggagtttgtcaacggcatgacggtgtacagctgtaagaacccttctctgcaatctgag
actgtccattacaagagaggcgttagccagcagttctccctgccttctttcaagattgac
ttctccgagtggaaggatgatgagctgaactttgacctggaccggggtgtgtttccagta
gtcatccaggctgtggtggatgaaggagatgttgtggaagtgactggccacgctcatgtg
ctcttggctgcctttgagaagcacgtggatggcagcttctccgtgaagccattaaagcag
aagcaaattgtggaccgggtcagctacctgctgcaagagatctacggcattgagaacaag
aacaaccaggagactaagccttccgacgatgagaacagtgacaacagcagtgagtgtgtg
gtgtgcctgtcagacttgcgggacacgctaatcctgccctgccgccacttgtgcctctgc
acttcctgtgctgacacgctgcggtaccaggccaacaactgccccatctgccggctgcca
ttccgagctctcctacagatccgggctgtacggaagaagccaggagctctgtctcccatc
tccttcagtcctgtcttggcccaaagtgtggaccacgatgaacactctaattctgacagt
gtcccacctggctatgagcccatctccttgctcgaggcactcaatggactacgggctgtc
tccccggctatcccatcagctcccctctatgaggaaatcacctactcaggcatctcggac
ggtctttcccaggccagttgtccccttgctggactcgatcgaatcatagaaaatggaata
cagaagggcaagacacagagcaagtctccagacagcaccctgcggtctccatcatctccc
attcatgaggaggatgaggagaagctctcagaggacccggaggctcctctcccaccaagc
ggtgtggagctcgtgcttcaggagagcagctcccctgagagtttcggaacagaggaggtg
ggtgagccatccctaaagcaaggaagccgagtaccctctattgatgatgtcctgcaggat
ggcagtccccagcatcatggttgcagccagccagtccctcctgctgacatctacctacca
gccctgggtcctgagtcgtgctctgttggtatagaggagtaa

DBGET integrated database retrieval system