KEGG   Rattus norvegicus (rat): 302976Help
Entry
302976            CDS       T01003                                 

Gene name
Noxo1
Definition
(RefSeq) NADPH oxidase organizer 1
  KO
K17934  NADPH oxidase organizer 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    302976 (Noxo1)
Membrane trafficking [BR:rno04131]
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    302976 (Noxo1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PX SH3_1 SH3_9
Motif
Other DBs
NCBI-GeneID: 302976
NCBI-ProteinID: NP_001100456
RGD: 1307802
Ensembl: ENSRNOG00000025117
UniProt: D4ACU5
Position
10q12
AA seq 235 aa AA seqDB search
MASPRHPVSAHAVALVQMERLQTFAFSVCWSDNSDTFARRSWEEFRQLQKTLKKIFPVEA
GLLQRSERVLPKLPDAPLLTRRGHTGRGLLRLRLLETYVRSLLATSQHIVTSSTLNSFFA
PKPLDLEPMLPPGSLVILPTPEEPLSQPIGSLAIHSLEAQSMRCLQPFHTLDTKDRPFHT
QAKEILDILLRHPSGWWLVENKDQQTAWFPAPYLEEIATGQGQESGMAVQGSGMS
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atggcaagtccaagacacccagtatcagcccatgctgtagccctggtgcagatggaacgg
ctccagacgtttgccttctctgtgtgctggtcagacaacagtgacacctttgctcgcagg
agctgggaggagtttaggcagctccagaagacccttaagaaaatcttcccagtggaggca
ggcctgcttcagagatctgaacgagttcttcccaagcttcctgatgctccattgttgaca
cgtcggggacatactggccgaggcctgttacgtttgcggctgctggaaacctatgtacgg
tcactgctggcaacctcacagcacatagtgacgagctcaacactcaatagcttctttgca
cccaaacctctggatctggagcccatgctgcctcctggcagcctggtgatcctgcccacc
ccagaggagcccttatcccaacctataggcagccttgccattcatagcctggaggctcag
agcatgcgctgcttacagccattccacactcttgacacaaaagacagacctttccacact
caggctaaagaaattctggacatattactacggcatccttcaggctggtggctggtggag
aacaaggaccagcagacagcctggtttccagctccctacctggaggagatagcaacaggc
caaggccaggagtcgggcatggctgttcaaggaagtggtatgagctaa

DBGET integrated database retrieval system