KEGG   Rattus norvegicus (rat): 302986Help
Entry
302986            CDS       T01003                                 

Gene name
Telo2, RGD1305553
Definition
(RefSeq) telomere maintenance 2
  KO
K11137  telomere length regulation protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03460  Fanconi anemia pathway
rno04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    302986 (Telo2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    302986 (Telo2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:rno03032]
    302986 (Telo2)
   03400 DNA repair and recombination proteins [BR:rno03400]
    302986 (Telo2)
DNA replication proteins [BR:rno03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     302986 (Telo2)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    Other FA pathway factors
     302986 (Telo2)
  Check point factors
   Triple T complex
    302986 (Telo2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Telomere_reg-2
Motif
Other DBs
NCBI-GeneID: 302986
NCBI-ProteinID: XP_001059179
RGD: 1305553
Ensembl: ENSRNOG00000016774
UniProt: D3ZQ30
Position
10q12
AA seq 834 aa AA seqDB search
MDPALSAVRLTVQEAIHTLSSSEDAGHILSTLGTLKRYLGRTEDPVLPEEKEEFATVHFS
AVLRCLVSKLSPGWLELSPDGQLEQLWESFFLDGPPDQAFLVLMEAIESTAGPSFRLMKM
ARLLDTFLHAGRVAALMEEQCRPQTKPSFPLFQETLLSKVVGLPDLLGNRLQRDNLTQFF
PQNYFPLLGLEVMRALKAAVNFLQGGLDCSVSFVSQVLGKVCIQGRKKEILGVLVPQLTV
LTQDSCLWQRVCWRLVEQVPDRAVEAVLTGLVEAAPRPEVLSRLLGNLVVKNKKARFVMT
RKLLFLQYQHTTPMVQSLLGYLALDSQRRPLLIQVLKELLETWGSSSAVRHAPLEQQCYI
SKAILVCMAHLGESELQDVRDELLASMMAGVKCRLDSSLPPVRRLGMVVAEVISSRIHPE
GPPLKFQYEDDEMSRELLALAAPGPASDCSLEARGPSPAPVATEPPVETPEKTMESDVHP
AQPQGSDSELDSDDEFIPYDMSGDKELKSSKEPLYIRDCVEALTTSEDIERWEASLKVLE
GLVYRNPQATREVSVELAKVLLHLEEKTCVAEFEQLRQRALVAVTVTDPEQVAKYLTSQF
YGLNYSLRQRMDILDVLVLAAQALSRPRSLQRLSQHSSPASGTSRSPALAISQPDWQVVV
EERIRSKTRRFSKGCPRREVSGVPNEFNSVAGYFFFPLLQHFDRPLVTFDLLGDDQLVLG
RLTHTLASLMYLAVNTTVAVPMGKALLEFVWALRFHVDIYVRRGLLSAVSSVLLSVPTER
LLGDLPDELLEARSWLADVAERDVDEDCRELAVRSLLLLERLKDKLLSSCSPQP
NT seq 2505 nt NT seq  +upstreamnt  +downstreamnt
atggacccagcactgtctgctgtcaggctcaccgtccaggaagccattcacaccctttca
tcctcagaggatgctggccatatcctttctaccctggggactctgaagcgatacctcggt
agaaccgaggatccagttcttcctgaggagaaggaggagtttgccaccgtccacttctca
gccgtcctcagatgtctggtcagcaagctcagtccaggctggctggagctatctcccgat
ggccagctggagcagctttgggagagctttttcctggacggcccgccagaccaagccttc
ctggtgctgatggaagccattgagagcactgctggccctagcttccgtctgatgaagatg
gctcggctgctggacacatttctgcacgccggcagagtggccgctctcatggaggagcag
tgtcggccgcagacaaagcccagcttccccctgttccaggagacgctgctcagcaaagtc
gtgggcttaccggatctcctgggcaaccgtctccagcgggacaacctgacccagttcttc
ccccagaattacttccctctgctgggcctggaggtcatgcgggcactaaaggcggccgtg
aactttctccaaggtggtctagactgctctgtctcctttgtgtctcaagttctggggaag
gtgtgcatccaggggcgaaagaaagagatcctgggtgtgctggtgccccagctgacagtg
ctcacccaggacagctgtctgtggcaacgggtgtgctggcgcctggtggagcaagtgcct
gaccgggcagtggaggccgtgctgacaggacttgtagaggccgctcccaggcctgaagtc
ctgtcacgactactagggaacctggtggtgaagaataagaaagcacggtttgtgatgacc
cggaagcttctgttcctgcagtaccagcacacaacacccatggtgcagagcctgctgggg
tacttggctttagacagtcagcgtcggccactcctcatacaggtgcttaaggagctgctg
gagacctggggcagcagcagtgccgtccggcacgcacccctggagcaacagtgttacatc
agcaaggccatccttgtgtgcatggcacacctcggggagtcggagctgcaggacgtccgg
gatgaattgctggccagcatgatggcaggtgtgaagtgccgcctggacagcagcctaccc
cctgtgcgtcgcttgggcatggttgtggccgaagtcatcagctccaggatccaccccgag
gggcctcccctgaaattccaatacgaagacgatgagatgagccgagagttgctggctttg
gctgctccagggcctgcgagtgactgctccttggaggcacgaggcccatccccagctcct
gttgccacagagcctcctgtagagacaccagaaaagaccatggagagtgatgtccaccca
gctcagccacagggctctgactcagagcttgacagtgatgatgagttcatcccctacgac
atgtcaggggacaaagagctgaagagcagcaaggagcccctgtatatccgagactgtgtg
gaagccttgactacatctgaggacatagaacgctgggaggcttccctaaaggtgcttgag
ggcctggtgtataggaacccccaggccactcgggaggtaagcgtggagctggccaaggtg
ctactgcacctggaagagaagacctgtgtagcagagtttgagcagctgcgccagagggct
ctggtggctgtcacagtcacagacccggagcaggtagccaagtatctgacctcacagttc
tatggcctgaactatagcctccggcagcgcatggacatcctggatgttctcgttcttgct
gcccaggcactgtctcggccaaggagcctccagagactctcccagcacagttcccctgct
tcgggcacctcgcgttcaccagcactggctatttctcagcctgactggcaggtagttgtg
gaggagcggatcagaagcaagacgaggaggttctccaagggctgtcctcggagggaggtg
tcaggcgtccccaatgaattcaactccgtggctggatatttcttcttccccctcctacag
cactttgacaggcctctggtgaccttcgaccttttaggagacgatcagttggtactcgga
agactgacccacaccttagcgtccctgatgtacctggctgttaacaccacagtggctgtg
cctatgggtaaggccctgctggagtttgtatgggcccttcgcttccacgttgacatttat
gtccgccggggcttgctgtctgctgtgtcctctgtcctcctcagtgtacctacagagcgg
ctgttgggggacctgccagatgagctactggaagccagatcctggttggcagatgtggct
gagagggatgtggatgaggactgcagggagctggcagtaaggtctttgctgctcctggag
agactcaaagacaagctcctgtccagttgctctccacagccctga

DBGET integrated database retrieval system