KEGG   Rattus norvegicus (rat): 302991
Entry
302991            CDS       T01003                                 

Gene name
Tekt4, RGD1308075, Tek4, Tektin4
Definition
(RefSeq) tektin 4
  KO
K18631  tektin-4
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    302991 (Tekt4)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Others
     302991 (Tekt4)
SSDB
Motif
Pfam: Tektin Med9 APG6_N Spc24 TMF_DNA_bd
Other DBs
NCBI-GeneID: 302991
NCBI-ProteinID: NP_001013987
RGD: 1308075
Ensembl: ENSRNOG00000018792
UniProt: Q6AXV2
Position
10q12
AA seq 447 aa
MAQAEVLLTKEPAPQSIDVCELPQKKYEVACNTGAYTSAGLATAGFRTAKYLMDEWFQNS
YARYHQAFADRDYSERQRHESKQLAAETGELAYRTQLDSTRRVGERLEDMHCWKSELQRE
IDELSSETDQMMAQKLRLQRALDALSVPFSIATDNLQCRERRQHPDLVRDYVEVELLKET
ELIRNIQELLKRTMGQAVGQIRLNREHKENCEINWSDKVEVYNIDDTCARYTNESTQVQF
YPHSSKFEESASTPETWGKFTQDVLLRAERERLASVNLRKLIDCILRDTAEDLRLQCDAV
NLAFSNRCEELNDARQKLQYHLLKILSEITDQEHQIAALKQAIKDKEAPLRVAQTRLYQR
SHRPNVELCRDNAQFRLMSEVEELNMSLKVLKEKLQDAEQALRNLEDSRMSLEKDIAVKT
NSLFIDRQKCMTHRNRYPSVLQLAGYQ
NT seq 1344 nt   +upstreamnt  +downstreamnt
atggcacaagccgaagtgctcctgaccaaggagccagccccgcagtcaattgatgtctgt
gagctaccccaaaaaaaatatgaagtggcttgtaataccggtgcctatacatccgccggt
ctggccaccgctggcttccgcacagccaaatacctcatggacgagtggtttcagaactct
tatgcacgctaccaccaggcctttgcagaccgggactactctgagaggcagcggcatgaa
agcaagcagctggcagccgagactggggaacttgcctatcgcacacaacttgactccaca
cgaagggtgggagagcgtctggaggacatgcattgctggaagtcggagctgcagcgagag
atagacgagctgtcttccgagactgatcagatgatggcccagaagcttcggctacaacgc
gccttggatgctttgtccgtgcccttctccatcgctactgacaacctacagtgccgagaa
cgccgccagcacccagaccttgtccgggactatgtggaggtggagctgctgaaggaaact
gaactcatcaggaacatccaggaactcctgaagaggacgatgggacaagctgtgggccag
atacggctgaaccgggaacataaggagaactgtgagataaactggtcagacaaagtagaa
gtctacaacattgacgatacctgcgcccgctacaccaatgagagcacccaggtgcagttt
tatccgcattccagcaagttcgaggagagtgcctccacgcctgagacgtggggtaagttc
actcaggacgtcctgcttcgagccgagcgcgaacggctagcctcggttaacctgcggaag
ttaattgactgcatcctgagggatactgccgaggacctgcggttgcagtgcgacgcagta
aacctggctttctcaaaccgctgcgaagagctgaacgacgcacgccaaaagctgcagtac
cacctgctaaagatcctgagtgagatcacggaccaggaacaccagattgcagccttgaag
caggccatcaaggacaaggaggcccctctgcgtgtggcccaaactcgactttaccagagg
tcacaccggcccaatgtggagttgtgccgggacaatgcccagttcaggttgatgagcgag
gtggaggagctgaacatgtccctcaaagtgctaaaggagaagcttcaggatgcagagcag
gcactgcggaacctggaggactcacgcatgagtctagagaaggacatcgcagtcaagacc
aacagccttttcatcgaccgccagaagtgtatgacccaccgcaaccgctacccctcggtc
ctccagctggctggctaccagtga

DBGET integrated database retrieval system