KEGG   Rattus norvegicus (rat): 302993Help
Entry
302993            CDS       T01003                                 

Gene name
Sox8
Definition
(RefSeq) SRY box 8
  KO
K09270  transcription factor SOX7/8/10/18 (SOX group E/F)
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    302993 (Sox8)
Transcription factors [BR:rno03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   HMG SOX
    302993 (Sox8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HMG_box Sox_N HMG_box_2
Motif
Other DBs
NCBI-GeneID: 302993
NCBI-ProteinID: NP_001100459
RGD: 1309072
Ensembl: ENSRNOG00000018841
UniProt: D3ZR96
Position
10q12
AA seq 463 aa AA seqDB search
MLDMSEARAQPPCSPSGTASSMSHVEDSDSDAPPSPAGSEGLGRAGGGGRGDTAEAADER
FPACIRDAVSQVLKGYDWSLVPMPVRGGGGGTLKAKPHVKRPMNAFMVWAQAARRKLADQ
YPHLHNAELSKTLGKLWRLLSESEKRPFVEEAERLRVQHKKDHPDYKYQPRRRKSVKTGR
SDSDSGTELGHHPGGPMYKTDTVLGDAHRHSDHTGQTHGPPTPPTTPKTDLHQASNGSKQ
ELRLEGRRLVDSGRQNIDFSNVDISELSSEVISNMDTFDVHEFDQYLPLNGHSALATEPS
QATASGSYGGASYSHSGATGIGASPVWAHKGAPSASASPTEAGPLRPHIKTEQLSPSHYN
DQSHGSPGRADYGSYSAQASVTTAASATAASSFASAQCDYTDLQASNYYSPYPGYPPSLY
QYPYFHSSRRPYASSLLNGLSMPPAHSPSSNWDQPVYTTLTRP
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgctggacatgagtgaggcccgcgcccagccgccctgcagcccgtctggcactgctagc
tccatgtcacacgtggaggattcagactccgacgcgccaccgtcgcccgcgggatcagag
ggcttgggccgcgcggggggcggcggccgaggggataccgctgaggcagcagacgaacgc
ttcccagcctgcatccgtgatgccgtgtcgcaggtgcttaagggctatgactggagtctg
gtgcctatgccggtgcgcggcggcggtggcggcacactcaaggccaagccacacgtgaag
cggcccatgaatgccttcatggtgtgggcacaggcggcgcgccgcaagctggcggaccag
tacccgcatctccataacgcagagctcagcaagaccctgggcaagctgtggcgcttgctg
agtgaaagcgagaagcggccattcgtggaggaggccgagaggctccgtgtgcagcacaag
aaggaccacccagattacaaataccagccgaggagaaggaagagtgtgaaaaccggccgg
agcgactcggactctggtactgaactgggccaccaccctggtggtcccatgtacaaaacg
gacacagtgctaggtgatgcacaccgccacagcgaccacacaggccagacccatgggcca
cccaccccacccaccacccccaagacggacctgcaccaggccagcaatggaagcaagcaa
gagctaaggctggaagggcgccgcctggtggacagcgggcgccagaacatcgacttcagc
aatgtggacatctccgagctcagcagcgaggttatcagtaacatggataccttcgatgtc
cacgagtttgaccagtacttacccctcaatggccactcagccctggccactgagcccagc
caggccactgcctctggctcctatggaggcgcttcctactcccactccggtgcaactggc
ataggcgcatcccctgtgtgggcccacaagggagctccctcggcctcagcctcgcccaca
gaggcaggaccccttcggccacatatcaagacggagcagctgagtcccagccattacaac
gaccagtcacacggctcacccggccgtgccgactatggctcctacagcgcccaggccagt
gtcaccacggctgcctcggccacagctgccagctctttcgccagcgcacagtgtgactac
actgacctgcaggcttccaactactacagcccctaccctggctaccctcccagcctctat
caatacccttacttccattcatcccgccggccctatgcctcgtcactgctcaatgggctc
tccatgccccccgcacacagccccagcagcaactgggaccagcctgtgtacaccaccctg
acccggccctga

DBGET integrated database retrieval system