KEGG   Rattus norvegicus (rat): 303016
Entry
303016            CDS       T01003                                 

Gene name
Crebrf, RGD1310862
Definition
(RefSeq) CREB3 regulatory factor
  KO
K21554  CREB3 regulatory factor
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99973 Transcription
    303016 (Crebrf)
SSDB
Motif
Pfam: bZIP_1 bZIP_2
Other DBs
NCBI-GeneID: 303016
NCBI-ProteinID: NP_001264086
RGD: 1310862
Ensembl: ENSRNOG00000020769
UniProt: D4A811
Position
10q12
AA seq 640 aa
MPQPSVSGMDPPFGDAFRSHTFSEQTLMSTDLLANSSDPDFMYELDREMNYQQNPRDNFL
SLEDCKDIENLETFTDVLDNEDALTSNWEQWDTYCEDLTKYTKLTSCDIWGTKEVDYLGL
DDFSSPYQDEEVISKTPTLAQLNSEDSQSVSDSLYYPDSLFSVKQNPLPPSSFPSKKITS
RAAAPVCSSKILQAEVPSSDCVQKASKPTSSTQIMVKTNMYHNEKVNFHVECKDYVKKAK
VKINPVQQGRPLLSQVHIDAAKENTCYCGAVVKRQEKRGVEPHQGHGTPALPFRETQELL
LSPLPQHGPGLVATAESGSLSASTSVSDSSQKKEEHNYSLFVSDNMREQPTKYSPEDDED
DEDDIDDEDHDEGFGSEHELSENEEEEEEEEDYEDDRDDDISDTFSEPGYENDSVEDLKE
MTSISSRKRGKRRYFWEYSEQLTPSQQERILRPSEWNRDTLPSNMYQKNGLHHGKYAVKK
SRRTDVEDLTPNPKKLLQIGNELRKLNKVISDLTPVSELPLTARPRSRKEKNKLASRACR
LKKKAQYEANKVKLWGLNTEYDNLLFVINSIKQDIVNRVQNPREERGPSMGQKLEILIKD
TLGLPVAGQTSEFVNQVLGKTAEGNPTGGLVGLRIPASKV
NT seq 1923 nt   +upstreamnt  +downstreamnt
atgcctcagcccagcgtaagcggaatggatccgccttttggggatgcctttcgaagccac
accttttcagaacagactctgatgagcacagatctcttagccaacagttctgatccagat
ttcatgtatgagctggatagagagatgaattatcaacagaatcctagagacaacttcctt
tctttggaagactgcaaagacattgaaaatctggagactttcacagatgtcctggacaat
gaggatgctttgacttcaaactgggaacagtgggatacatactgtgaagacttaactaag
tataccaaactaaccagctgtgacatctgggggacaaaagaagtggattacctgggtctt
gatgacttttctagcccttaccaagatgaagaggtcatcagtaaaactccaaccttggcc
cagctcaatagtgaggactctcagtctgtttctgattccctttattatcctgattcactc
ttcagtgtcaaacaaaaccccttgcccccctcttcttttcctagtaaaaagatcacaagt
agagcagctgcccctgtgtgctcttcaaagatacttcaggctgaggtcccatcgtcagac
tgtgtccaaaaagcaagcaaacctacttcaagcacacagatcatggtgaagaccaacatg
tatcataatgaaaaagtgaattttcatgtcgaatgtaaagactatgtaaaaaaagcaaaa
gtcaagatcaaccctgtgcaacagggccggcccttgctgagccaggtgcacatagatgcg
gcaaaggagaacacctgctactgtggcgctgtggtaaagaggcaggagaagaggggggtg
gagcctcaccagggtcatggcactcctgctttgcctttcagagaaacccaggaactatta
cttagtcctctgccccagcatggtcctgggttggttgccacagcagagagtggcagcctt
tctgccagcacttctgtttcagattcgtcccagaaaaaagaagagcacaattattctctt
tttgtctctgacaacatgagagaacagccaaccaaatacagtcctgaagatgatgaggat
gatgaagatgatattgatgatgaggaccatgatgaagggtttggcagtgagcatgagctt
tctgaaaatgaagaggaggaagaagaggaagaggattatgaggatgacagagatgatgat
atcagcgacacattctctgaaccaggctatgaaaacgactctgtagaggacttgaaggag
atgacttccatatcttctcggaagagagggaaaagaaggtacttctgggagtatagtgag
cagttgacgccatcacagcaagagaggattctgaggccatctgagtggaatcgagacacc
ttgccaagtaatatgtaccagaaaaatggcttacatcatgggaaatacgcagttaagaag
tcacggagaactgatgtggaagacctgactccaaatcctaaaaaactactccagattggt
aatgaactacggaaactgaataaggtgatcagtgacctgactccagttagtgagcttccc
ttaacagcgaggccaaggtcaaggaaagaaaaaaataagctggcttccagagcttgtagg
ctgaagaagaaagcccagtatgaagccaataaagtgaagctctggggcctcaacactgaa
tatgacaatttattatttgtaatcaactccatcaagcaagacattgtaaaccgagttcag
aatccaagagaggagagaggacccagcatggggcagaagcttgaaatcctcattaaagac
acactcggtctcccagtcgctgggcaaacctcagaatttgttaaccaagtgttagggaag
actgctgaaggcaaccccactggaggccttgtaggactaaggataccagcatcaaaagtg
taa

DBGET integrated database retrieval system