KEGG   Rattus norvegicus (rat): 303059Help
Entry
303059            CDS       T01003                                 

Gene name
Ccnjl
Definition
(RefSeq) cyclin J-like
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Cyclin_C Cyclin_N
Motif
Other DBs
NCBI-GeneID: 303059
NCBI-ProteinID: NP_001032862
RGD: 1561384
Ensembl: ENSRNOG00000003893
UniProt: F1LPN6
Position
10q21
AA seq 387 aa AA seqDB search
MDEPWWEGRVASDVHCTLREKELKLPTFRAHSPLLKSRRFFVDILTLLSRHCHLCPSARH
LAIYLLDHFMDQYNVTTSKQLYTVAVSCLLLASKFEDREDRVPKLDQINSTRILSSHNFS
LTKKELLTTELLLLEAFSWDLCLPTPAHFLDYYLLASISQKDHHCHTWPTTCLRKTKECL
KEYAHYFLEVTLQDHIFYKFQPSVVAAACVGASRICLQLSPYWTRDLQRVSNYSLEHLST
CIEILLVAYDNVLKDAVAVKSQALAMVPSSSSAPTQVLFQPPTYPSLSQPPPTTLAQFQS
PAQDLCLAYRDSLQAHRSGTLLSGDTGPSLHTPYPTLQPLDMCPVPVPASLSMQMAIAAE
PRHCLTATYGSSYFSGSHMFPTGCFDS
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atggatgagccgtggtgggaagggcgggtcgcctcggacgtccactgcactctgcgcgag
aaggaactgaagctgcccaccttccgtgcccactccccgctcctgaagagccggcggttc
tttgtagacattctgaccctgctaagcagacactgccatctctgcccctcggcccggcac
ctggccatctaccttttggaccactttatggaccagtacaacgtcaccacctccaagcag
ctgtacactgtggctgtctcctgcctcctgctggcaagtaagtttgaggacagagaagac
cgtgtgcccaaattggatcagataaacagtacaaggatcctgagcagccataacttctcc
ctcaccaagaaggagctgctcaccacagaacttctgctcctggaggctttcagctgggac
ctttgcctgcccacgcccgcccactttctggactactacctcttggcctccatcagccag
aaggaccaccactgccacacatggcccaccacctgcctccgaaagaccaaagagtgcctc
aaggagtacgcccactacttcctggaagttaccctacaagatcatatattttacaaattc
cagccttctgtggtcgctgcagcctgtgttggggcctccaggatctgccttcagctttct
ccatactggacgagagacttgcagagggtctcgaactactccctggagcatctcagcacg
tgcatcgaaatcctgctggtagcatatgacaatgtcctcaaggatgccgttgcagtcaag
agccaggcactggccatggtgcccagctcatcatcagctcccacccaagtgctgttccaa
ccacccacctacccttctctcagccagccaccgccaacaacactagcccagttccagagt
ccagcgcaggacttgtgcttggcatatcgggactcgttgcaggcccaccgctcagggacc
ctgctctcaggagacactggtccatccctccacacgccatacccaacccttcagcccttg
gatatgtgtcctgtgcccgttcctgcatcccttagcatgcagatggccatagcagctgaa
cccaggcactgccttactgccacctacggaagcagctacttcagcgggagccatatgttc
cccacaggctgttttgacagctag

DBGET integrated database retrieval system