KEGG   Rattus norvegicus (rat): 303060
Entry
303060            CDS       T01003                                 

Gene name
Pwwp2a, RGD1305891
Definition
(RefSeq) PWWP domain containing 2A
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: zf-C3HC
Other DBs
NCBI-GeneID: 303060
NCBI-ProteinID: NP_001120768
RGD: 1305891
Ensembl: ENSRNOG00000003936
UniProt: B2RYP9
Position
10q21
AA seq 533 aa
MAAVAAEAAATAASPGDGGAGEAEPELEPIPGSEAGTPLPVTATEAAVPDGEADGRQSAP
QADEQPLPPPPPPPPPGELAGSSEAEEAKPPEPAAVPVPPPEQPPAAPEQPEDAPRPPPA
PALVPPAGGDSAVSHLIPGSEVRVTLDHIIEDALVVSFRLGEKLFSGVLMDLSKRFGPHG
IPVTVFPKRECKDKPDAMQLQSNTFQEGIEVKREVNGAIPDALSPVPPPDCLWTSKPPPL
FHEGAPYPPPLFIRDTYNQSIPQPPPRKIKRPKRKMYREEPTSIMNAIKLRPRQVLCDKC
KNSVVAEKKEIRKGSSDSSRYEDKKRRNDSVATVNKKLKTDHKVDGKNQNESQRRNAVVR
VSSIPHSRGRVVKVSAQANTSKAQLNTKKVLQSKNMDHAKAREVLKIAKEKAQKKQSETS
TSKNAHSKVHFTRRYQNPSSGSLPPRVRLKPQRYRNEENDSSLKTGLEKIRSGKLAPKPQ
SRCTSTRSAGLNKWQLLHQTVTSPAAPLQCLTDHCGFRLGALKLTVKRAAQRH
NT seq 1602 nt   +upstreamnt  +downstreamnt
atggcggccgtggctgctgaggcggcggcgaccgcggcgtcccccggggacgggggcgcc
ggtgaggccgagccggagctagagcccattccgggcagtgaggccggcacccccctcccg
gtcacggccacggaggcggcggtgccggacggcgaggccgatgggcgccagtccgcccct
caggccgacgagcagccgctgccgccgccgccgccgccgccaccgccgggggagctggct
ggtagctccgaggctgaggaggcgaagccgcctgagcccgcggctgtcccggtcccgccg
cccgagcagcctccggccgccccggagcagccggaggacgcgccacggccgccgccagct
ccggcgctcgtgccgccggcgggcggggactcagcggtatcgcacctcatcccgggctcg
gaggtgcgggtcacgctggaccacatcatcgaggacgcgctcgtggtgtcgttccgcctc
ggggagaagctcttctccggggtcctcatggacctgtctaaaaggtttgggccccatggg
atccctgtgacagtatttcccaaaagggaatgtaaggacaaaccggacgccatgcagctt
caaagtaacacattccaagaagggatagaagtcaagcgggaagtgaatggtgctattccc
gatgccctttctccagtccctcctcctgattgcctgtggacttccaaaccacctcctctc
ttccatgaaggagcaccttatcctccccccttgtttatcagggacacatataaccaatca
atacctcagcctcctccccggaaaattaagcgacccaaacgaaaaatgtacagggaagaa
cccacttcaataatgaatgcgataaagctacgtcccaggcaagtcctgtgtgataagtgt
aaaaacagtgttgttgcagaaaagaaggaaattaggaaaggtagcagtgactcttctagg
tatgaagataaaaaacggagaaacgatagtgtagctactgtgaacaaaaaactgaaaact
gaccataaagtggatgggaaaaaccaaaacgaaagccagagaaggaatgctgtggtgagg
gtttccagtatccctcatagcaggggcagagtagtcaaggtttctgctcaggcaaataca
tcaaaagctcagttaaataccaagaaagtgcttcagagcaagaacatggatcacgcaaaa
gctcgggaagtattgaaaattgccaaagaaaaggcacagaagaagcaaagtgaaacctcc
acttccaaaaatgcgcactcgaaagtccatttcacacgccggtatcagaatcctagctca
ggttctctcccacctcgagtgcgcttaaaaccacaacggtacaggaatgaagaaaacgac
tcttctctgaagacgggactggagaaaattcggagtggcaagctggcccctaagccgcag
tctcgatgtacctccacccgctcagcaggtctcaacaaatggcagctattacatcagaca
gtgacgagtcctgctgctcccttacagtgtctgacagaccactgtggattcagactggga
gcattgaagttaacagtgaagcgggcagcacaaagacattag

DBGET integrated database retrieval system