KEGG   Rattus norvegicus (rat): 303073Help
Entry
303073            CDS       T01003                                 

Gene name
Cyfip2
Definition
(RefSeq) cytoplasmic FMR1 interacting protein 2
  KO
K05749  cytoplasmic FMR1 interacting protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03013  RNA transport
rno04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    303073 (Cyfip2)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    303073 (Cyfip2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    303073 (Cyfip2)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     303073 (Cyfip2)
   Factors involved in mRNA localization
    Other mRNA localization factors
     303073 (Cyfip2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FragX_IP
Motif
Other DBs
NCBI-GeneID: 303073
NCBI-ProteinID: NP_001100466
RGD: 1305048
Ensembl: ENSRNOG00000006557
UniProt: D3ZX82
Position
10q21
AA seq 593 aa AA seqDB search
MSSTPWICTTTAPTMRSPSSKSSSCMTRSKQRQVNLCFDQFVYKLADQIFAYYKAMAGSV
LLDKRFRAECKNYGVIIPYPPSNRYETLLKQRHVQLLGRSIDLNRLITQRISAAMYKSLD
QAISRFESEDLTSIVELEWLLEINRLTHRLLCKHMTLDSFDAMFREANHNVSAPYGRITL
HVFWELNFDFLPNYCYNGSTNRFVRTAIPFTQEPQRDKPANVQPYYLYGSKPLNIAYSHI
YSSYRNFVGPPHFKTICRLLGYQGIAVVMEELLKIVKSLLQGTILQYVKTLIEVMPKICR
LPRHEYGSPGILEFFHHQLKDIIEYAELKTDVFQSLREVGNAILFCLLIEQALSQEEVCD
LLHAAPFQNILPRVYIKEGERLEVRMKRLEAKYAPLHLVPLIERLGTPQQIAIAREGDLL
TKERLCCGLSMFEVILTRIRSYLQDPIWRGPPPTNGVMHVDECVEFHRLWSAMQFVYCIP
VGTNEFTAEQCFGDGLNWAGCSIVVLLGQQRRFDLFDFCYHLLKVQRQDGKDEIIKNVPL
KKMADRIRKYQILNNEVFAILNKYMKSVETDSSTVEHVRCFQPPIHQSLATTC
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atgtcctctaccccttggatctgtacaacgacagcgcctactatgcgctcaccaagttca
aaaagcagttcctgtatgacgagatcgaagcagaggcaagtgaacctgtgctttgatcag
tttgtctacaagctggctgaccagatctttgcctactacaaagccatggccggcagtgtc
ctgttggacaaacgttttagagctgaatgtaagaactatggagtgatcattccgtacccg
ccatctaaccggtacgagacactgctgaaacagagacacgtccagctgttgggtagatca
attgacttgaacagactcatcacgcagcggatctctgccgccatgtacaaatccttggac
caggcaatcagccgctttgagagcgaagacctgacctccattgtggagctagagtggctt
ctggagattaaccggctcacacaccgactcctctgtaagcacatgacgctagacagcttc
gacgccatgttccgagaagccaatcataatgtgtctgccccctatggccgcatcaccctg
catgtcttctgggagctgaactttgacttcctccccaactactgctataacggctccacc
aaccgctttgtccgcactgccatccctttcacccaagaaccacaacgggataagcccgcc
aatgtccagccttactacctctacggatccaagcctctcaacattgcctacagccacatc
tacagctcctaccgcaactttgtggggccccctcacttcaagaccatctgcagactgctg
ggctaccagggcatcgccgtggtcatggaggaactgctgaaaatcgtcaagagcttgctc
cagggtaccattctgcagtacgtgaagacactcatagaggtgatgcctaaaatatgccgt
ttgcctcgtcacgagtatggctctccagggatcctggagttcttccaccaccaactgaag
gacatcatcgagtatgcagaactcaaaacagacgtgttccagagtctcagagaggtgggc
aatgccatcctgttctgcctcctcatagagcaagctctgtctcaagaggaagtctgtgat
ttgctccatgccgcacccttccaaaacattctgcctcgggtctatatcaaagagggggag
cgtctggaagtccggatgaaacgcctcgaggccaagtacgccccacttcacctggtcccc
ctgatagagcgactggggacgcctcagcaaattgccatcgctcgggagggtgacctgctg
accaaggagcggctctgctgtggcctgtccatgttcgaggttatcctgacccgaattcgg
agctacctgcaggaccccatctggaggggcccgccacccaccaatggcgtcatgcacgtg
gatgagtgtgttgagtttcaccggctgtggagcgccatgcagtttgtctactgcatccct
gtggggaccaacgagttcacagctgagcagtgcttcggtgatggcttgaactgggctggc
tgctctatcgttgtcttgctgggccagcaacggcgctttgacctgtttgatttctgttat
catctgctgaaggtgcagaggcaggacgggaaggatgagatcattaagaatgtgcccctg
aagaagatggctgaccgcatcaggaagtaccagatcttgaacaatgaggtttttgccatt
ctgaacaagtacatgaagtccgtagagacagacagctccacggtagagcacgtacgctgc
ttccagcccccaatccaccagtccctggccaccacctgctag

DBGET integrated database retrieval system