KEGG   Rattus norvegicus (rat): 303073
Entry
303073            CDS       T01003                                 

Gene name
Cyfip2
Definition
(RefSeq) cytoplasmic FMR1 interacting protein 2
  KO
K05749  cytoplasmic FMR1 interacting protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03013  RNA transport
rno04810  Regulation of actin cytoskeleton
rno05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    303073 (Cyfip2)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    303073 (Cyfip2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    303073 (Cyfip2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    303073 (Cyfip2)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     303073 (Cyfip2)
   Factors involved in mRNA localization
    Other mRNA localization factors
     303073 (Cyfip2)
SSDB
Motif
Pfam: FragX_IP
Other DBs
NCBI-GeneID: 303073
NCBI-ProteinID: NP_001100466
RGD: 1305048
Ensembl: ENSRNOG00000006557
UniProt: D3ZX82
Position
10
AA seq 593 aa
MSSTPWICTTTAPTMRSPSSKSSSCMTRSKQRQVNLCFDQFVYKLADQIFAYYKAMAGSV
LLDKRFRAECKNYGVIIPYPPSNRYETLLKQRHVQLLGRSIDLNRLITQRISAAMYKSLD
QAISRFESEDLTSIVELEWLLEINRLTHRLLCKHMTLDSFDAMFREANHNVSAPYGRITL
HVFWELNFDFLPNYCYNGSTNRFVRTAIPFTQEPQRDKPANVQPYYLYGSKPLNIAYSHI
YSSYRNFVGPPHFKTICRLLGYQGIAVVMEELLKIVKSLLQGTILQYVKTLIEVMPKICR
LPRHEYGSPGILEFFHHQLKDIIEYAELKTDVFQSLREVGNAILFCLLIEQALSQEEVCD
LLHAAPFQNILPRVYIKEGERLEVRMKRLEAKYAPLHLVPLIERLGTPQQIAIAREGDLL
TKERLCCGLSMFEVILTRIRSYLQDPIWRGPPPTNGVMHVDECVEFHRLWSAMQFVYCIP
VGTNEFTAEQCFGDGLNWAGCSIVVLLGQQRRFDLFDFCYHLLKVQRQDGKDEIIKNVPL
KKMADRIRKYQILNNEVFAILNKYMKSVETDSSTVEHVRCFQPPIHQSLATTC
NT seq 1782 nt   +upstreamnt  +downstreamnt
atgtcctctaccccttggatctgtacaacgacagcgcctactatgcgctcaccaagttca
aaaagcagttcctgtatgacgagatcgaagcagaggcaagtgaacctgtgctttgatcag
tttgtctacaagctggctgaccagatctttgcctactacaaagccatggccggcagtgtc
ctgttggacaaacgttttagagctgaatgtaagaactatggagtgatcattccgtacccg
ccatctaaccggtacgagacactgctgaaacagagacacgtccagctgttgggtagatca
attgacttgaacagactcatcacgcagcggatctctgccgccatgtacaaatccttggac
caggcaatcagccgctttgagagcgaagacctgacctccattgtggagctagagtggctt
ctggagattaaccggctcacacaccgactcctctgtaagcacatgacgctagacagcttc
gacgccatgttccgagaagccaatcataatgtgtctgccccctatggccgcatcaccctg
catgtcttctgggagctgaactttgacttcctccccaactactgctataacggctccacc
aaccgctttgtccgcactgccatccctttcacccaagaaccacaacgggataagcccgcc
aatgtccagccttactacctctacggatccaagcctctcaacattgcctacagccacatc
tacagctcctaccgcaactttgtggggccccctcacttcaagaccatctgcagactgctg
ggctaccagggcatcgccgtggtcatggaggaactgctgaaaatcgtcaagagcttgctc
cagggtaccattctgcagtacgtgaagacactcatagaggtgatgcctaaaatatgccgt
ttgcctcgtcacgagtatggctctccagggatcctggagttcttccaccaccaactgaag
gacatcatcgagtatgcagaactcaaaacagacgtgttccagagtctcagagaggtgggc
aatgccatcctgttctgcctcctcatagagcaagctctgtctcaagaggaagtctgtgat
ttgctccatgccgcacccttccaaaacattctgcctcgggtctatatcaaagagggggag
cgtctggaagtccggatgaaacgcctcgaggccaagtacgccccacttcacctggtcccc
ctgatagagcgactggggacgcctcagcaaattgccatcgctcgggagggtgacctgctg
accaaggagcggctctgctgtggcctgtccatgttcgaggttatcctgacccgaattcgg
agctacctgcaggaccccatctggaggggcccgccacccaccaatggcgtcatgcacgtg
gatgagtgtgttgagtttcaccggctgtggagcgccatgcagtttgtctactgcatccct
gtggggaccaacgagttcacagctgagcagtgcttcggtgatggcttgaactgggctggc
tgctctatcgttgtcttgctgggccagcaacggcgctttgacctgtttgatttctgttat
catctgctgaaggtgcagaggcaggacgggaaggatgagatcattaagaatgtgcccctg
aagaagatggctgaccgcatcaggaagtaccagatcttgaacaatgaggtttttgccatt
ctgaacaagtacatgaagtccgtagagacagacagctccacggtagagcacgtacgctgc
ttccagcccccaatccaccagtccctggccaccacctgctag

KEGG   Rattus norvegicus (rat): 308666
Entry
308666            CDS       T01003                                 

Gene name
Cyfip1
Definition
(RefSeq) cytoplasmic FMR1-interacting protein 1
  KO
K05749  cytoplasmic FMR1 interacting protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03013  RNA transport
rno04810  Regulation of actin cytoskeleton
rno05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    308666 (Cyfip1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    308666 (Cyfip1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    308666 (Cyfip1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    308666 (Cyfip1)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     308666 (Cyfip1)
   Factors involved in mRNA localization
    Other mRNA localization factors
     308666 (Cyfip1)
SSDB
Motif
Pfam: FragX_IP DUF1394 zf-CW
Other DBs
NCBI-GeneID: 308666
NCBI-ProteinID: NP_001100987
RGD: 1310332
Ensembl: ENSRNOG00000011945
UniProt: D4A8H8
Position
1
AA seq 1253 aa
MAAQVTLEDALSNVDLLEELPLPDQQPCIEPPPSSLLYQPNFNTNFEDRNAFVTGIARYI
EQATVHSSMNEMLEEGQEYAVMLYTWRSCSRAIPQVKCNEQPNRVEIYEKTVEVLEPEVT
KLMNFMYFQRNAIERFCGEVRRLCHAERRKDFVSEAYLITLGKFINMFAVLDELKNMKCS
VKNDHSAYKRAAQFLRKMADPQSIQESQNLSMFLANHNKITQSLQQQLEVISGYEELLAD
IVNLCVDYYENRMYLTPSEKHMLLKVMGFGLYLMDGSVSNIYKLDAKKRINLSKIDKYFK
QLQVVPLFGDMQIELARYIKTSAHYEENKSRWTCTSSSSSPQYNICEQMIQIREDHMRFI
SELARYSNSEVVTGSGRQEAQKTDAEYRKLFDLALQGLQLLSQWSAHVMEVYSWKLVHPT
DKYSNKDCPDNAEEYERATRYNYTTEEKFALVEVIAMIKGLQVLMGRMESVFNHAIRHTV
YAALQDFSQVTLREPLRQAIKKKKNVIQSVLQAIRKTVCDWETGHEPFNDPALRGEKDPK
SGFDIKVPRRAVGPSSTQLYMVRTMLESLIADKSGSKKTLRSSLEGPTILDIEKFHRESF
FYTHLINFSETLQQCCDLSQLWFREFFLELTMGRRIQFPIEMSMPWILTDHILETKEASM
MEYVLYSLDLYNDSAHYALTKFNKQFLYDEIEAEVNLCFDQFVYKLADQIFAYYKVMAGS
LLLDKRLRSECKNQGATIHLPPSNRYETLLKQRHVQLLGRSIDLNRLITQRVSAAMYKSL
ELAIGRFESEDLTSVVELDGLLEINRMTHKLLSRYLTLDSFDAMFREANHNVSAPYGRIT
LHVFWELNYDFLPNYCYNGSTNRFVRTVLPFSQEFQRDKQPNAQPQYLHGSKALNLAYSS
IYGSYRNFVGPPHFQVICRLLGYQGIAVVMEELLKVVKSLLQGTILQYVKTLMEVMPKIC
RLPRHEYGSPGILEFFHHQLKDIVEYAELKTVCFQNLREVGNAVLFCLLIEQSLSLEEVC
DLLHAAPFQNILPRVHVKEGERVDAKMKRLESKYAPLHLVPLIERLGTPQQIAIAREGDL
LTKERLCCGLSMFEVILTRIRTFLDDPIWRGPLPSNGVMHVDECVEFHRLWSAMQFVYCI
PVGTHEFTVEQCFGDGLHWAGCMIIVLLGQQRRFAVLDFCYHLLKVQKHDGKDEIIKNVP
LKKMVERIRKFQILNDEIITILDKYLKSGDGESTPVEHVRCFQPPIHQSLASS
NT seq 3762 nt   +upstreamnt  +downstreamnt
atggctgcccaagtgacactagaggacgcactgtccaatgtggacctcctggaagagctg
cctcttcctgaccagcagccctgcattgagcccccaccttcctcgctgctctatcagcca
aatttcaacaccaactttgaagaccgaaatgcatttgtcactggcattgcaagatacatt
gaacaagcaactgtccactctagcatgaacgagatgctagaggaaggccaagagtatgct
gtcatgctgtatacctggaggagctgctcccgtgccatccctcaggtgaagtgcaatgag
cagcctaatagggttgaaatttatgagaaaactgtggaagtccttgaacccgaggtcaca
aaactgatgaattttatgtacttccagagaaatgccatcgagcgtttctgtggggaggtg
agacgcctgtgtcatgctgagaggagaaaggacttcgtgtctgaagcctacttgatcacc
ttgggcaagtttatcaacatgtttgctgtgttggatgagctgaagaacatgaagtgcagt
gtgaagaatgaccactcagcgtataagagggctgctcagtttttacgtaaaatggcagat
ccacaatccatccaggagtcacagaatttgtccatgttcctggccaaccacaacaagatt
acacaatctctacagcaacagcttgaggtcatttctggctatgaagaactcctggcagac
atagtgaatctgtgtgtggactactatgagaacagaatgtacttgacgcccagcgaaaaa
cacatgcttctcaaagtcatgggatttggtctgtacctgatggatgggagtgtgagtaac
atctacaaactagatgccaagaaaagaataaatttatccaaaatagacaagtatttcaag
cagctgcaggtggttccactctttggagatatgcagatagaactggcaagatacatcaag
accagcgcacactatgaggagaataagtcccggtggacctgtacgtcctcgagcagcagc
ccacagtacaacatctgtgagcagatgatccagatccgtgaggaccacatgcgtttcatt
tctgagctggcacgctacagcaatagcgaggtagtcacagggtctggccggcaggaggcc
cagaagacagatgctgagtaccggaagctctttgacctggcgctgcagggcctgcagctt
ctgtcgcagtggagcgcgcatgtgatggaagtgtattcctggaaacttgtacatccaaca
gacaagtactccaacaaggactgcccagacaatgctgaggagtatgaacgtgccacgcgt
tacaactacaccactgaggagaagtttgctctggtggaggtgattgccatgatcaaaggc
ctgcaggtgctgatgggcaggatggagagtgtgttcaatcacgccatcagacacacagtt
tatgctgcacttcaggacttctcccaggtgaccctcagggaaccactgcgacaggccatc
aagaagaaaaagaatgtcatccagagtgtcctacaggccatcaggaagactgtgtgtgac
tgggagactgggcatgaaccctttaacgacccagctctgcggggagagaaggaccctaag
agcggctttgacatcaaggtgccacgccgtgctgtaggaccctccagcacacagctttac
atggtgagaactatgctagagtccctcattgcagacaaaagtggttccaagaaaaccttg
agaagtagccttgaggggcccaccatattggacatagaaaaatttcatcgagaatcattc
ttctacactcacttgataaatttcagtgaaacactgcagcagtgctgtgacctttcccag
ctgtggttccgagagttcttcctggagctgaccatgggcaggaggatccagttccccatt
gagatgtctatgccctggattctgactgaccacatcctagagaccaaggaggcatcaatg
atggagtacgtcctctactccttggacctgtacaatgacagtgctcactatgcgctcacc
aagttcaacaagcagtttctctatgatgaaattgaagcagaggtgaatctgtgttttgac
caatttgtttataaactggcagaccagatatttgcatattacaaggttatggcaggaagt
ttgcttcttgacaaacggttacgatcagaatgcaaaaatcagggagccacgattcacctc
ccaccgtctaaccgctatgagacgttgttgaagcaaaggcacgtgcagctgcttgggaga
tccatcgatctcaatcgtctgattacacagcgtgtttcagcagccatgtacaaatctcta
gaactggcaattggacgatttgaaagtgaagatttaacatcagtagtcgagctagatggg
ctcttagaaatcaaccgtatgacgcacaagctgctgagtaggtacctcacactagacagc
tttgatgccatgttccgggaagccaaccacaacgtgtctgcaccttatggaagaatcacc
ctccatgtcttctgggagctaaactatgacttcttgcccaactactgctataatggctcc
accaaccggtttgttcggacagtactaccattttctcaggaatttcaacgagacaaacaa
cctaatgcacagccccagtatttgcacggctccaaggctttgaacctagcctactcaagc
atttatggcagctaccggaactttgtggggcctcctcacttccaggtcatctgccggctg
cttggctaccagggcattgcagtcgtcatggaagaactgctgaaggttgtcaagagcctg
cttcaaggcacaatcctgcagtatgtgaaaactctgatggaagtgatgcctaagatctgc
cgccttccccgacatgagtacggctctcctggcatcctagagttcttccaccaccagctg
aaggacattgtggagtatgcagagctgaaaacagtatgcttccagaacctgcgggaggtg
ggaaatgctgttctcttctgcctgctcatcgagcaaagcctgtctttagaagaagtctgt
gacctgttgcatgcagctccttttcagaatatcctgcctcgagtccacgtaaaagagggg
gagagagttgatgccaaaatgaaaagactagaatccaagtatgctccactgcatcttgtt
ccgctgattgaaaggctggggaccccacagcaaattgcaatcgcaagagagggggacttg
ctgaccaaggagcggctctgttgtggtctgtccatgtttgaagtcatcctcacacggatc
cggacctttctggatgatcccatctggcgtgggcccctgcccagcaatggggtcatgcat
gtggatgagtgtgtggagtttcacagactatggagtgccatgcagtttgtttactgcatt
cctgtagggacacacgagtttacagtggagcagtgttttggcgatgggctccactgggct
ggctgcatgatcattgtacttctgggacagcagcggcgctttgctgtgttggatttctgc
tatcatcttctcaaagttcagaaacacgatggcaaggatgagatcatcaaaaatgtgcca
ttgaagaagatggtggagaggattcgcaagttccagattctcaatgatgagatcatcact
atcctggacaagtacttgaaatctggagatggggagagcacacctgtggaacatgtacgc
tgcttccagccacccatccaccagtccctagccagcagctga

DBGET integrated database retrieval system