KEGG   Rattus norvegicus (rat): 303112Help
Entry
303112            CDS       T01003                                 

Gene name
N4bp3, C330016o10rik, RGD1308356
Definition
(RefSeq) Nedd4 binding protein 3
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Fez1 Vezatin
Motif
Other DBs
NCBI-GeneID: 303112
NCBI-ProteinID: NP_001029065
RGD: 1308356
Ensembl: ENSRNOG00000021731
UniProt: Q3LUD3
Position
10q21
AA seq 537 aa AA seqDB search
MATASGPAGIAMGSVGSLLERQDFSPEELRAALAGSRGSRQPDGLLRKGLGQREFFSYLH
LPKKDGKTAKRAPRNEPDYTTLYYREHPRAGDFSKTSLPERGRFDKCRIRPSVFKPPVST
GKGFLSMQSLAAHKGQKLWRSNGSLHTLACHPPLSPGPRASQARAQLLHALSLDEGGPEP
SLSDSSSGGSFGRSPGTGPSPFSSSLGHINHLGGSLDRASRSPKESGPLAVLSCLPEPPP
PYEFSCPTTEEVAVLPDTCEELKRDLGDQDVSNPFTQVLEERQRLWLSELKRLYVDRLHE
VAQKAERSERNLQLQLFMAQQEQRRLRKELRAQQGLAPEPRTSGPPMEADPNARPEEEAR
WEVCQKTAEISLLKQQLREAQAELAQKLAEIFSLKTQLRGSRAQAQAQDAELARLREAVR
SLQEQAPREEAPGSCETDDCKSRGLLGEAGGNEAREGAEQLRAELLQERLRGQEQALRFE
QERQTWQEEKERVLRYQREIQGSYMDMYRRNQALEQELRVLREPPTSWSPRLESSKI
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atggccacagcctcaggccctgctggcattgccatgggcagcgtaggcagcctgttggaa
cggcaggacttttcccctgaagaacttcgggctgcactagctgggtcccggggctcccgg
cagcctgatgggctcctccggaaaggcttgggccaacgagagttcttcagctacctgcat
ctccccaagaaggatggcaagaccgccaagcgagcccctcggaacgagccggactacacc
accctctactaccgggagcatcctcgggctggtgacttcagcaagacttccctacctgag
cgcggtcgcttcgacaagtgccggatccgtccttctgtgttcaagcctcctgtgagcact
gggaaaggcttcctgtccatgcagagcctcgcagcccacaagggccagaagctgtggaga
agcaatggcagcctgcacactctggcctgtcacccccccctgagccctgggcctcgggcc
agtcaggcccgtgcacagttgcttcatgccctcagccttgatgaaggcggccctgagccc
agcttatcggactcttccagcgggggtagttttggccgtagtccagggactggccccagc
cccttcagctcctccctgggccacattaatcaccttggaggctccctggatcgtgcttca
aggagccctaaggagtctggacctctggcagtactgagctgcctgcccgagccacctccc
ccctatgagttctcctgtcccactactgaggaggtcgctgtgttgcctgatacctgtgag
gaactcaagagggacctcggtgaccaggatgtatctaacccctttactcaggtgctcgag
gaacgccagcggttgtggttgtctgagctgaagcgcctgtacgtggaccggcttcacgag
gtggcccagaaagctgagcgcagcgagcgcaacctccagctgcagctgtttatggctcaa
caggagcagcggcgcctgcgcaaggagctgcgggctcagcagggcctggccccagagcct
cggacctccgggccccccatggaggctgaccccaatgcccggccagaggaagaagcccga
tgggaggtgtgccagaagactgccgagattagtctgttgaaacagcagcttcgggaagcc
caggcggagctggcacagaagctggcagagatcttcagtctgaagacacaacttcggggc
agccgggcacaagcccaagctcaggacgctgagctagcccggctgcgggaggcagtgcgc
agcctgcaagagcaggcacctcgggaggaagccccaggcagctgtgagacagatgactgc
aagagcagggggctgctcggggaggcaggaggcaatgaagccagagaaggggccgagcag
ctgagggcagagctgctgcaagaacggcttcgtggccaggagcaggctctgcgctttgag
caggagaggcagacttggcaggaggaaaaagagagggtgctgcgctaccagcgagaaatc
caagggagctacatggacatgtaccgccggaaccaggcacttgaacaggagctgcgggtg
ctgcgggagccccctacatcttggagtcccaggctggagtcctccaagatctga

DBGET integrated database retrieval system