KEGG   Rattus norvegicus (rat): 303130
Entry
303130            CDS       T01003                                 

Gene name
Fstl4
Definition
(RefSeq) follistatin-like 4
  KO
K23914  follistatin-related protein 4
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    303130 (Fstl4)
Peptidases and inhibitors [BR:rno01002]
 Peptidase inhibitors
  Family I1: Kazal family
   303130 (Fstl4)
SSDB
Motif
Pfam: Ig_3 I-set Ig_2 ig Kazal_2 EF-hand_6 V-set EF-hand_5 Kazal_1 Ig_6 EF-hand_7 C2-set_2 EF-hand_1 EF-hand_8
Other DBs
NCBI-GeneID: 303130
NCBI-ProteinID: NP_001100470
RGD: 1307227
Ensembl: ENSRNOG00000006565
UniProt: D3ZJ81
Position
10q22
AA seq 832 aa
MKPGGFWPHLALLGVSLPAVLGWMDQGASRSPNVVLGQSQTEETRGFEVTRREGLPSPGL
SSSCGKKLCSHGSRCLHNRTTGQPLCHCLEVCRPRYMPVCGSDGKLYGNHCELRRAACLL
GKRIVSVHSKDCFLKGDMCTVAGYARLKNVLLALQSRRQPLQQETHRQSLASQKRLLVES
LFKALDTDGNGRLGSLELAQYVLKEQDMDGSLNRCSPGDLLRFDDYNSDGSLTLGEFYTA
FQVIQLSLAPEDKVSVTTVTVGLSTVLTCAIRGDLRPPIIWKRNGLTLSFLGLEDINDFG
EDDSLYITKVTTIHMGNYTCHALGHEQLFQTHVLQVNVPPVIRVYPETQAQEPGVAASLR
CHAEGIPLPRIVWLKNGMDVSTQMSKQLSLLANGSELHIRSVRYEDTGAYTCIAKNEVGV
DEDISSLFIEDSARKTRLSVGNMFYVFSDDGIVVIHPVDCEVQRRFKPTEKIFMSYEEIC
PRVEGDTTQPCQWASAVNVRNRYIYVAQPALNRVLVVDVQAQKVLQSIGVDPLPAKLSYD
KSHDQVWVLSWGDMHKSQPSLQVITEASTGQGQHLIRTPFAGVDNFFIPPTNLIINHIRF
GFIFNKTDPAVHKVDLETLMSLKTISLQHYGCMPQAMAHTHLGGYFFVQCRQDTPTSTGP
QLLIDSVTDSVLGPNSDITGTPHVSPDGRFIVSVSNKGPWLHVQEVTVRGEIQTLYDLKI
NPGISDLAFQHSFTEGNQYNAYATLDKEPDLLFLELSTGKMGRLKNLKEPSRGPAPPWGG
PRRVLRDSGLFGQYLLTAAQDSLFLVNGRQNALRCEVSGIKGAATVVWVGEV
NT seq 2499 nt   +upstreamnt  +downstreamnt
atgaaaccaggaggcttctggccacatctcgccctacttggggtctccttgcctgctgtg
ctgggatggatggaccaaggagccagcagaagcccgaatgtggttctaggacagtcacag
acagaggaaaccagaggctttgaagtcacaagaagagaaggtcttcccagccctgggctg
tcatcctcctgtgggaagaaactctgcagccacgggagcaggtgcttgcacaataggaca
acagggcagcccctgtgccactgtctggaggtgtgcaggccccgctacatgcctgtgtgc
ggctccgacgggaagctctacgggaaccactgcgagcttcgccgtgcagcctgcctgctg
ggcaagcgaattgtcagtgtacacagcaaagactgcttcctcaaaggtgacatgtgcacc
gtggctggctatgctcgcctcaaaaatgtccttctggcactccagagccgcagacagccg
ctccaacaagaaacccacaggcaaagtctcgcctcccagaagcgcctcttggtggagtca
ctgtttaaggccttggataccgatggcaatggccgcctcggcagcttggagctggctcag
tatgtgctaaaggagcaggacatggacggttcactgaacagatgctcaccaggcgacctc
ctgagatttgacgactataatagcgatggctccttgacccttggagagttctacacagcc
ttccaggtgattcaactgagcctcgcccctgaggacaaggtcagcgtgaccacagtgacc
gtgggcctgagcacagtgctgacctgtgctattcgtggagacctgaggccaccaatcatc
tggaagcgcaatgggctcaccctgagcttcctgggtctggaagacatcaatgacttcggc
gaggatgattccctgtacatcaccaaggtgaccacaatccacatgggcaactacacctgc
cacgccttgggccatgagcagctgttccagacccacgtcctgcaggtgaatgtgccacca
gtcatccgtgtctatccagagacccaggcacaagaacctggggtggcagccagccttcga
tgccacgctgagggcatccccctgcccagaatcgtttggctgaaaaatggcatggatgtc
tcaacccagatgtccaaacagctctccctcttggccaatggaagcgaactccacatccgc
agcgttcgctatgaagacaccggggcgtacacctgcattgccaagaatgaagtgggtgtg
gatgaagatatctcctccctcttcattgaggactcagctagaaagacacgtctcagcgtg
ggaaacatgttctacgtcttctccgatgatggtattgttgtcatccaccctgtggactgt
gaggtccagagacgcttcaaacctacagagaagatcttcatgagttatgaagaaatctgt
cctcgtgtggaaggagatactacccagccatgtcaatgggcgtccgcagtcaatgtcagg
aaccggtacatctacgtggcccagccagcactgaacagagtccttgtggtcgacgtgcaa
gcccagaaggtcttacagtccataggtgtggaccctctaccagctaagctgtcctatgac
aagtcacatgaccaagtgtgggtcctgagctggggggacatgcacaagtcccagccaagc
ctacaggtcatcacagaagccagcaccggccaaggccagcacctcatccgaacaccgttt
gcaggagtggacaacttctttatacctccaacaaatctcatcatcaaccatatcaggttt
ggcttcatcttcaacaagactgaccctgccgtccacaaagtcgacttggagactctgatg
tcactcaagacaatcagcctacagcactacggctgtatgcctcaggccatggcacataca
caccttggcggctacttctttgtgcagtgtcgacaggacacccctacctccactggtcca
cagctgctcattgacagtgtcacagactcagtgctaggccccaacagtgatatcacgggt
accccccacgtgtcccctgacgggcgctttatcgtcagcgtctccaacaagggcccctgg
ctgcacgtgcaggaggtcacagtccggggggagatccagactctatacgatctaaaaata
aacccgggcatctccgacttggcattccagcattccttcacggaaggtaatcagtacaac
gcctacgccactctggacaaggagccagacctgctgtttctggagctgtccactgggaag
atgggtaggctgaagaacttaaaggagccatccaggggaccagccccaccctggggtgga
ccccgaagagtcctgagagacagcgggctctttggacagtacctcctcacagcagctcaa
gactcactgttcctggtcaatgggagacaaaacgccctgaggtgcgaggtgtcaggcata
aaaggtgcggccacagtggtgtgggtcggggaggtatga

DBGET integrated database retrieval system