KEGG   Rattus norvegicus (rat): 303132Help
Entry
303132            CDS       T01003                                 

Gene name
Aff4, Laf4l
Definition
(RefSeq) AF4/FMR2 family, member 4
  KO
K15185  AF4/FMR2 family member 4
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    303132 (Aff4)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Super elongation complex (SEC)
     303132 (Aff4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AF-4
Motif
Other DBs
NCBI-GeneID: 303132
NCBI-ProteinID: NP_001100471
RGD: 1311694
Ensembl: ENSRNOG00000006965
UniProt: D3ZSX2
Position
10q22
AA seq 1150 aa AA seqDB search
MNREDRNVLRMKERERRNQEIQQGEDAFPPSSPLFAEPYKVTSKEDKLSSRIQSMLGNYD
EMKDYIGDRSIPKLVAIPKPAVPTTTDEKANPNFFEQRHGGSHQSSKWTPVGPAPSTSQS
QKRSSGLQSGHSSQRSSAGGSGASGSGQRHDRDSYSSSRKKGQHGSEHSKSRSSSPGKPQ
AVSSLSSSHSRSHGNDHHSKEHQRSKSPRDPDANWDSPSRVPFSSGQHSSQSFPPSLMSK
SSSMLQKPTAYVRPMDGQESVEPKLSSEHYSSQSHGSNMTELKPSSKAHLTKLKIPSRPL
DASVSGDVSCVDEILKEMTHSWPPPLTAIHTPCKTEPSKFPFPTKESQQSNFGSGEQKRY
STSAKTSNGHQSKSMLKDDLKLSSSEDSDGEQDCDKTMPRSTPGSEGADNSRDDSSSHSG
SESSSGSDSESESSSSDSEANEPSQSASPEPEPPPTNKWQLDNWLNKVNPHKVSPASSVD
SNIPSSQAYKKEGREQGTASNYTDPGGAKEASSATPGRDSKTIQKGSESGRGRQKSPAQS
DSTTQRRTVGKKQPKKTEKSAAEEPRGGLKIESETPVDMATSMPSSRHKAATKGSRKPNI
KKESKSSPRPTAEKKKYKSASKSSQKSREIIETDSSSSDSDERESLPPSSQTPKYPESNR
TPVKPSSAEEDDSFFRQRMFSPMEEKELLSPLSDPDDRYPLIVKIDLNLLTRIPGKPYKE
TEPPKGEKKNVPEKHSREVQKQASEKASNKGKRKHKNDDDNRASESKKPKTEDKNSSAHK
PSSSKESSKQSSTKEKDLLPSPAGPVPSKDSKTEHGSRKRTVSQSSSLKSSSTSNKENSG
SSKSTSSTAKQKKTEGKVSSSSKEAKEKAPNSSSNCPPSTPTPDSSKPRRTKLAFDDRNY
SADHYLQEAKKLKHNADALSDRFEKAVYYLDAVVSFIECGNALEKNAQESKSPFPMYSDT
VELIKYTMKLKNYLAPDATAADKRLTVLCLRCQSLLYLRLFKLKKENALKYSKTLTEHLK
NSYSNSQAPSPGLGSKAVGMPSPVSPKLSPGNSGSYSSGGSSASASGSSVTIPQKIHQMA
ASYVQVTSNFLYATEIWDQAEQLSKEQKEFFAELDKVMGPLIFNASIMTDLARYTRQGLH
WLRQDAKLIS
NT seq 3453 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgtgaagaccggaatgtgctgcgcatgaaagaaagggaaaggcggaatcaggaa
attcagcagggtgaagacgccttcccacctagttctcctctctttgctgagccgtacaaa
gttactagcaaagaagataagttatcaagtcgtattcagagtatgcttggaaactacgat
gaaatgaaggattacataggagacagatctataccaaagcttgttgcaattcccaagcct
gcagtaccgacgacaacagacgagaaagcaaacccaaatttttttgaacagagacatgga
ggatctcatcagagtagcaagtggactcctgtaggacctgcacccagcacctctcagtct
cagaagcgctcctctggcttgcagagtggacacagtagccagcggagcagtgcaggtggg
agtggcgctagtggtagtggccagaggcatgaccgtgactcctacagcagtagcaggaaa
aaaggccagcacgggtcagagcactccaaatcacgatcctcaagccctggaaaaccccag
gctgtttcttcactaagttctagtcattccaggtctcatgggaatgaccaccatagcaag
gaacatcagcgctccaaatcacctcgggaccctgatgccaactgggattctccttcccgg
gtacctttttcaagtgggcaacattcaagtcagtctttcccaccttctttgatgtcaaaa
tctagttcaatgttacagaaacccactgcctatgtacggcccatggatggacaggagtct
gtggaaccaaagctgtcctctgagcactacagcagccagtctcatggtagtaacatgact
gagctgaagcccagcagcaaagcacatcttaccaagctgaaaataccttcccgacctctg
gatgcatcagtttctggtgatgtaagctgtgtggatgaaatacttaaagagatgacgcac
tcatggcctccccctctaacggctattcatacaccatgcaaaacagaaccttccaaattt
ccttttccaactaaggagtctcagcagtctaactttggctctggagaacaaaaaagatac
agtacttctgctaaaacatcaaatggacaccagtcaaaatctatgttaaaagatgactta
aaactaagcagcagtgaagacagtgatggggaacaggattgtgataagacaatgccaagg
agtacaccaggaagtgagggagcagataactccagggatgactcaagcagccacagtggg
tctgaaagcagctctgggtccgactccgagagtgaaagcagctccagtgacagtgaggca
aatgagccatcccagagcgcatcccctgagcctgaaccaccaccaaccaacaagtggcaa
cttgataattggttgaacaaagtgaacccacataaagtgtccccagcttcctctgtagat
agcaacatcccatcgtctcaagcctacaagaaagaaggccgagagcagggcactgccagt
aactacacagatccaggtggggccaaagaagcgagctctgccactccgggacgagactct
aaaactatccaaaaaggatcagaaagtggccgtgggaggcagaagtctcctgcacagagt
gacagtaccacacagaggagaactgttggcaaaaaacaacccaaaaaaactgagaagtca
gctgctgaagagccccgaggaggcctgaagatagaaagtgagacccctgtggacatggct
accagcatgccctccagcaggcataaggcagccaccaagggctcaaggaaacctaacatc
aaaaaggagtcgaaatcttcccctcgacctacagcagagaaaaagaaatacaagtcagca
agtaaatcctcccagaaatctcgggaaatcatagaaacagatagctcctcctcagattca
gatgagagggagagcctccctccctcctcccagactcctaagtaccctgagagcaatagg
actcctgtcaaaccctcctcggcggaggaagacgatagctttttccggcagcggatgttc
tctcctatggaagagaaggagctcctttccccactcagtgaccctgatgacaggtaccca
ctcattgtgaagatagacctgaatcttttgactagaatacccgggaagccttacaaagaa
acagagccacccaagggggaaaagaaaaatgttccagaaaaacactcaagagaggtgcag
aagcaagcctcagaaaaggcttccaacaaaggcaagaggaaacacaagaatgatgatgat
aaccgagccagtgagagcaaaaaacccaagacggaggacaagaactcatcagcccacaag
ccatccagcagcaaagagtcatcgaagcagagtagtacaaaagaaaaggacttgctacct
tcacctgctgggcctgttccttcaaaagattcaaaaacagagcatggctctcggaagagg
actgtcagtcagtcatcatccttaaagtccagcagtaccagcaacaaagagaacagtggc
agcagcaagagcacttcctccacagcaaaacagaagaagactgaagggaaggtttccagc
agctccaaagaggccaaggagaaggctccaaatagctcctctaattgtcctccgtctaca
ccaactcctgattcttcgaagcctcgaagaacgaagctcgcctttgatgacagaaattat
tcagcagaccattatttacaagaagcaaaaaaactcaaacacaatgcagatgctttgtct
gataggtttgagaaagctgtgtactaccttgatgccgtagtgtctttcattgaatgtggg
aatgcattagagaagaacgctcaggaatccaagtctccattccctatgtactcagacaca
gtggagcttattaaatacactatgaaactaaagaattatttggcgccagatgctacagct
gcagacaagagactcacagtactttgcctgagatgccagtcattgttgtacctgaggctg
ttcaaactgaagaaggagaacgctctgaagtactccaagacgctgactgagcacctgaag
aattcttacagtaattctcaagcaccttcacctggcttggggagcaaagctgttgggatg
ccctcccctgtttctccaaagctgtcaccaggcaattctggaagttactcttctggggga
agtagtgcttcagcaagtggttcttcggtgaccattccacagaaaatccaccagatggca
gcaagctatgtccaggttacatctaacttcctctatgccacagaaatttgggaccaagct
gaacagctttccaaagaacaaaaagaattctttgctgaactggacaaagtgatgggccct
ctcatctttaatgcaagcatcatgacagatctggctcgttacacccggcagggactgcat
tggcttcggcaggatgccaagctgatatcttga

DBGET integrated database retrieval system