KEGG   Rattus norvegicus (rat): 303141
Entry
303141            CDS       T01003                                 

Gene name
Rapgef6
Definition
(RefSeq) rap guanine nucleotide exchange factor 6
  KO
K08020  Rap guanine nucleotide exchange factor 6
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
rno04530  Tight junction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    303141 (Rapgef6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    303141 (Rapgef6)
SSDB
Motif
Pfam: RasGEF RasGEF_N PDZ RA cNMP_binding PDZ_6 PDZ_2 Tcp10_C
Other DBs
NCBI-GeneID: 303141
NCBI-ProteinID: NP_001100473
RGD: 1307645
Ensembl: ENSRNOG00000009995
UniProt: D3ZTL8
Position
10
AA seq 1606 aa
MNSPVDPGARQALRKKPPERTPEDLNIIYSYLHGMEILSNLREHQLRLMSTRARYERYNG
NQMLFCSETIARCWYILLSGSVLVKDSMVLPPCSFGKQFGGKRGCDCLVLEPSEMIVVEN
SKDNEDSILQREIPARQSRRRFRKINYKGERQTIIDGVDVNNYLSLPADLTKMHLTDNPH
PQVTHVTSSQSGCSIASDSGSSSLSDIYQATESEVGDVDLTRLPEGPVDSEDEEEEEEEI
DRTDPLQGRDLVRECLEKEPADKTDDDVEQLLEFMHQLPAFANMTMSVRRELCSVMIFEV
VEQAGAVILEDGQELDSWYVILNGTVEISHPDGKIENLFMGNSFGIVPTLDKQHMRGVVR
TKVDDCQFVCIAQQDYWRILNHVEKNTHKVEEEGEIVMVHEHRELDRSGTRKGHIVIKAT
PERLIMHLIEEHSIVDPTYIEDFLLTYRTFLETPLDVGIKLLEWFKIDSLRDKVTRIVLL
WVNNHFNDFEGDPAMTRFLEEFEKNLEDTKMNGHLRLLNIACAAKAKWRQVVLQKASRES
PLHFSLTGGSEKGFGVFVEVVEPGTKAADAGLKRGDQIMEVNGQNFENITFAKALEILRN
NTHLALTVKTNIFVFKELLSRTEQEKSGVPHIPKIAEKKSNRHSIQDVPGDIEQVPQEKG
NKKIKANTVSGGRNKIRKILDKTRFSILPPKLFSDGGLSQSQDDSIVGTRHCRHSLAIMP
IPGTLSSSSPDLLQPTTSMLDFSNPSDIPDQVIRVFKADQQSCYIIISKDTTAKEVVCQA
VQEFGLTGASDTYSLCEVSVTPEGVIKQRRLPDQFSKLADRIQLNGRYYLKNNMETETLC
SDEDAQELLKESQLSMLQLSTIEVATQLSMRDFDLFRNIEPTEYIDDLFKLDSKTGNTHL
KQFEDIVNQETFWVATEILSESNQLKRMKIIKHFIKIALHCRECKNFNSMFAIISGLNLA
PVARLRGTWEKLPSKYEKHLQDLQDLFDPSRNMAKYRNILSSQSMQPPIIPLFPVVKKDM
TFLHEGNDSKVDGLVNFEKLRMIAKEIRHIIRMTSANMDPAMMFRQRSLSQGSTNSNMLD
VQGGAHKKRARRSSLLNAKKLYEDAQMARKVKQYLSSLDIDTEEEKFQMMSLQWEPAYGT
LTKSLTEKKSARSSEMSPVPLRSAGHTAKVHLHQPHRVSQVLQVPAVNLHPIRKKGQTRD
HVLSTNLPQKGLGPTEEVSGKKHTEDTISVASSLHSSPPASPQSSPRKGCTLTPSSKCDN
LSDSSHSEISSRSSIVSNGSVDSMSAAGQDERCSAHSLAVPEPTGAWEKTDHPSGISDHS
QLAHGWMLSKPSLIKGVAVSSSLSSEEMSQEHVVLEAADSGRGSWTSCSSSSHDNFQSLQ
NQKSWDFLNSYRHTHLGDPIAEVEPPDCEPCACPKGCSRTCSQCKGSLETNQLRQSWASS
SSLSDTWEPNYGTVKRRVLESTPAEAPDGLEPRDTSDPVYKTVTSSTDKGLIVYCVTSPK
KGDRHREPPPTPPGYLGISLADLKEGSHPHLKPPDYSVAVQRSKMMLLNSLSRLPPAPPS
SHTSAWVPSKIGSQPQRHSLQPSHPKLADVADADSEADENEQVSAV
NT seq 4821 nt   +upstreamnt  +downstreamnt
atgaactcgcccgtggaccctggcgctcggcaggcactgaggaagaagccgccggagcgg
actcctgaggacttaaatattatttattcctatctccatgggatggaaatactatcaaac
ctcagggagcatcagcttaggttaatgtctacaagagcacgctatgagagatacaatggc
aatcaaatgcttttttgttcagaaactattgccagatgttggtatatcctgctttctgga
tctgtacttgtaaaagattctatggtccttcctccttgcagttttggtaagcagtttgga
ggaaaaagaggatgtgattgtcttgtattagaaccttcagaaatgattgtggtagaaaat
tccaaagacaatgaagatagtatattacaaagagaaattcctgccagacagtctcgacga
aggtttcggaaaattaactataagggagaacgccaaaccataatcgatggggtggatgtt
aataactacctttcgcttccagcagatcttaccaagatgcacctcacggacaaccctcat
ccacaggtcactcatgtgacttctagtcagtctggctgtagcattgccagtgactctggg
agcagcagtttatccgatatctatcaggctacagagagtgaagtaggagatgtagattta
acccgtcttcctgaaggacctgttgattctgaggatgaagaggaggaggaggaagagatt
gatcgaacagatccactgcagggtcgagatcttgtccgggaatgtcttgaaaaggaacct
gcagacaaaactgatgatgatgttgagcagttacttgagttcatgcaccagctacctgcc
tttgcgaacatgaccatgtctgtaaggagagagctctgctctgtcatgatttttgaagta
gtagagcaggctggggctgttattcttgaagatgggcaagagcttgactcgtggtatgtc
attttaaatggcactgtagaaattagccatccagatgggaaaattgaaaatctcttcatg
ggaaatagttttggaatcgtgcccactctggataagcagcacatgcgtggagttgtcaga
accaaagtcgatgattgtcagtttgtctgcatagcccaacaggactattggagaatttta
aatcatgttgaaaaaaacacccataaagttgaggaagagggagaaatcgtcatggtacat
gagcaccgtgagctagaccggagtggaactagaaaaggacacatcgtgatcaaggcgaca
cctgagcgtctcatcatgcatttgatagaagagcattctattgtggacccaacttatata
gaagatttcctattaacttacagaacatttcttgaaactcctttggatgttgggatcaag
cttttagaatggtttaagattgacagcttaagggataaggtgacccggattgtactctta
tgggtaaataatcattttaatgattttgaaggtgatcctgctatgactcgatttctagaa
gaatttgaaaaaaatttggaagatacaaaaatgaacggtcacctcagattactgaacatc
gcctgtgctgcaaaggctaagtggaggcaggttgtactgcagaaggcgtcccgtgagtcc
ccgctacacttcagcctcacgggaggcagcgagaagggatttggtgtctttgtagaagta
gtggagcctggtaccaaagctgctgacgcaggactgaaacggggtgatcagataatggaa
gtcaatgggcaaaactttgagaatattacgtttgctaaagcccttgaaattttgaggaat
aatactcatcttgcacttactgtgaagaccaacatttttgtgttcaaagaattgctcagt
aggactgaacaagagaaatctggtgtccctcatattcccaaaattgctgaaaaaaaaagt
aatcgtcattctattcaagatgtcccaggggatattgagcaggtgccacaggagaaagga
aacaagaaaattaaagcaaataccgtttcaggtggaagaaataaaatcaggaaaattttg
gataaaacaagatttagtatcttgcctccaaaactatttagtgacggaggcctgagtcaa
tcacaagatgacagcattgtgggaaccaggcactgtaggcacagcctggctatcatgcca
attcctggaacactgtcatccagcagcccagatctcttacagcctaccactagcatgttg
gacttttccaatccttcagatattcctgatcaagttataagagttttcaaagcagatcaa
caaagctgctacattatcatcagtaaagataccacagctaaagaagtggtctgccaagct
gtacaggaatttggtttgactggtgcatctgacacatactctctctgtgaagtttctgtt
actcctgagggtgttataaagcagagaagacttccggaccagttctccaaattagctgat
agaattcaactcaatggaaggtattacctaaaaaataacatggagacagaaacattgtgt
tctgatgaagatgcccaggaactactgaaagaaagccagctctccatgctgcagctcagc
accatcgaggttgccacccagctgtcaatgagggactttgatttgtttcgtaacattgag
cctactgaatatattgatgatctttttaaattagattccaaaacaggaaatactcacttg
aaacagtttgaggatattgtaaaccaagagacattctgggttgccacagagattctaagt
gagtcaaaccagctgaaaagaatgaagattattaaacattttattaaaattgcccttcat
tgccgagaatgcaagaatttcaattccatgtttgcaataataagtggcttgaacctggca
ccagtagcacgactcagaggcacctgggaaaagttaccaagcaaatatgagaaacacctt
caagatctacaagacctttttgatccatctagaaacatggcaaaatacagaaatattctt
agtagtcagagcatgcagcctccaattattccactcttccctgttgtcaagaaagatatg
acattccttcatgaaggaaatgactccaaagtagatggcttagtaaacttcgagaagcta
agaatgattgccaaggaaatccgtcatattattcgaatgacttctgctaacatggaccct
gccatgatgtttcgccagaggtcattgagtcaaggcagcacaaattctaacatgctagat
gttcagggaggggctcacaaaaaaagagcacgccgcagctcactgctgaatgccaagaaa
ctgtatgaagatgcccaaatggcaaggaaagtgaaacagtatctttctagtctggacata
gacacagaggaggagaagttccagatgatgtcactgcagtgggagcctgcatatggtacc
ttgacaaagagcttaactgaaaaaaagtcagccagatcatctgagatgtctcctgtgccg
ttgaggtcagctggccacacagctaaagtccacttgcaccagccacacagagtgagccag
gtgcttcaggtgccagcagttaacttgcaccccatccggaagaaaggacaaaccagagac
catgtgctgagtacaaatttacctcagaaaggtttaggaccaactgaagaagtgagtggt
aagaaacacacagaagatactatttctgtagcgtcctctctacactctagtcctcctgca
tctcctcagagctcccctcgcaaaggttgtacactcacaccatcaagtaaatgtgacaac
ttatctgactccagccacagtgaaatctcctctcggtccagcattgtgagcaatggttct
gttgactccatgtcggcagctggacaggatgaacgctgttcggcccacagcctagcagtt
cctgagcccaccggggcatgggaaaagacagatcacccttcggggatctcagaccacagt
cagcttgctcacgggtggatgctgtcaaagccatctcttatcaagggcgtagccgtctcg
tcttctctgagcagcgaagagatgtctcaggagcatgttgtgctggaggcagctgacagt
ggtcggggcagttggacatcctgttccagcagctcccatgacaacttccagagccttcag
aatcaaaagagctgggactttctgaactcctacagacacacgcatctaggcgaccctatt
gctgaagttgagccccctgactgtgagccctgcgcctgtcctaaaggttgctcaagaact
tgtagccagtgcaaaggcagcctagagacgaaccagctgaggcagagttgggcctcatcc
agctcactgtctgacacgtgggaaccaaactacgggacagtcaagcggagggttttggaa
agtacaccagcagaggcacctgatggcttggagcccagggataccagtgaccccgtttat
aaaactgtcacttccagtacagacaagggcttgattgtgtactgtgtcacctcacccaag
aaaggtgataggcatagggagccacctcccactcctccaggatatctgggaatttcctta
gcggacctaaaggaaggatcccacccgcacctaaaacctccagactatagtgtggcagta
caaagatcaaagatgatgcttcttaacagcctgtctagactgccgccagctcctcccagt
agccacacctcggcctgggttccctcgaagatcggatcccagcctcaaaggcatagcttg
cagccgtcccatcccaaactagcagatgtggctgatgcagatagcgaagcagatgagaat
gagcaggtgtcagcagtctag

KEGG   Rattus norvegicus (rat): 310533
Entry
310533            CDS       T01003                                 

Gene name
Rapgef2
Definition
(RefSeq) rap guanine nucleotide exchange factor 2
  KO
K08018  Rap guanine nucleotide exchange factor 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04015  Rap1 signaling pathway
rno04530  Tight junction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    310533 (Rapgef2)
   04015 Rap1 signaling pathway
    310533 (Rapgef2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    310533 (Rapgef2)
SSDB
Motif
Pfam: RasGEF RasGEF_N RA PDZ PDZ_6 PDZ_2
Other DBs
NCBI-GeneID: 310533
NCBI-ProteinID: NP_001101154
RGD: 1306434
Ensembl: ENSRNOG00000021581
UniProt: F1M386 A0A0A0MP77
Position
2
AA seq 1294 aa
MGNSFGVSPTMDKEYMKGVMRTKVDDCQFVCIAQQDYCRILNQVEKNMQKVEEEGEIVMV
KEHRELDRTGTRKGHIVIKGTSERLTMHLVEEHSVVDPTFIEDFLLTYRTFLSSPMEVGK
KLLEWFNDPSLRDKVTRVVLLWVNNHFNDFEGDPAMTRFLEEFENNLEREKMGGHLRLLN
IACAAKAKRRSMTLTKPSREAPLPFILLGGSEKGFGIFVDSVDSSSKATEAGLKRGDQIL
EVNGQNFENIQLSKAMEILRNNTHLSITVKTNLFVFKELLTRLSEEKRNGAPHLPKIGDI
KKASRYSIPDLAVDVEQVIGLEKVNKKSKANTVGGRNKLKKILDKTRISILPQKPYNDIG
IGQSQDDSIVGLRQTKHIPAALPVSGTLSSSNPDLLQSHHRILDFSTTPDLPDQVLRVFK
ADQQSRYIMISKDTTAKEVVIQAIREFAVTATPEQYSLCEVSVTPEGVIKQRRLPDQLSK
LADRIQLSGRYYLKNNMETETLCSDEDAQELLRESQISLLQLSTVEVATQLSMRNFELFR
NIEPTEYIDDLFKLKSKTSCANLKKFEEVINQETFWVASEILRETNQLKRMKIIKHFIKI
ALHCRECKNFNSMFAIISGLNLAPVARLRTTWEKLPNKYEKLFQDLQDLFDPSRNMAKYR
NVLSGQNLQPPVIPLFPVIKKDLTFLHEGNDSKVDGLVNFEKLRMIAKEIRHVGRMASVN
MDPALMFRTRSLSQGSANATVLDVAQTGGHKKRVRRSSFLNAKKLYEDAQMARKVKQYLS
NLELEMDEESLQTLSLQCEPATSTLPKNPADRKPVKSETSPVAPRAGPQQKAQPQQPLAP
PQPSHKVSQGLQVPAVSLYPSRKKVPVKDLPPFGINSPQALKKILSLSEEGSLERHRKQA
EDTISNASSQLSSPPTSPQSSPRKGYALALSGTVDNFSDSGHSEISSRSSIVSNSSFDSV
PVSLHDERRQRHSVSIVESNLGVGRMERRTLMEPDQYSLGSYAPVSESRGLYAAATVISS
PSTEELSHDQGDRASLDAADSGRGSWTSCSSGSHDNIQTIQHQRSWETLPFGHTHFDYSG
DATGIWASGGHMDQIMFSDHSTKYNRQNQSRESLEQAQSRASWASSTGYWGEDSEGDTGT
IKRRGGKDVSTEAESSSMVPVTTEEAKPVPMPAHIAVTPSTTKGLIARKEGRYREPPPTP
PGYVGIPIADFPEGPCHPARKPPDYNVALQRSRMVARPTEAPAPGQTPPAATASRPGSKP
QWHKPSDADPRLAPFQPQGFAGAEEDEDEQVSAV
NT seq 3885 nt   +upstreamnt  +downstreamnt
atgggaaacagctttggtgtttcgcccaccatggacaaagagtacatgaaaggagtcatg
aggacaaaggtggatgactgccagtttgtctgcattgcccagcaagattactgccgtatt
ttgaaccaagtagaaaagaacatgcaaaaagttgaggaagaaggagagattgtaatggtg
aaggagcaccgagaacttgatcggactggaacaaggaagggccacatcgtcatcaagggc
acctcagagaggctaaccatgcatttggtggaagagcattctgtagtggacccaacattc
atagaagacttcctgttgacataccggactttcctttccagcccaatggaagtgggcaag
aagttattggagtggttcaatgacccgagcctcagggataaggtgacacgggtagtatta
ctgtgggtgaataatcacttcaatgactttgaaggagatcctgcaatgactcgatttcta
gaagaatttgaaaataatctggaaagagagaaaatgggtggacatctaaggctgctaaac
attgcatgtgcagcgaaagccaaacgaaggtcgatgacgttaacaaagccgtcccgggag
gcgcctctgcccttcatcctgctgggaggctctgaaaagggcttcggcatctttgtggac
agtgttgactcatcgagcaaagccactgaagcaggcttgaagcgtggggatcagatatta
gaagtgaatggtcaaaattttgaaaatatccaactttcaaaggcaatggaaattcttaga
aataacacacacctgtccatcactgtgaaaaccaacttatttgtatttaaagaacttctg
acgagattgtctgaagagaaaagaaatggtgccccccaccttcctaaaattggagacatc
aagaaggccagtcgctactccataccggatcttgctgtagatgtagaacaggtgataggc
ctcgagaaggtcaacaagaaaagcaaagccaacactgtggggggaagaaacaagctaaag
aaaatactcgacaagactcggatcagtatcttacctcagaaaccatacaatgatattggg
attggtcagtctcaagatgatagcatcgtaggactgaggcagaccaagcacattccagct
gccctgcctgtcagtggaacgctgtcttccagtaaccctgacttgctgcagtcacaccac
cggattctggacttcagcactactcctgacttgccagatcaggtactgagagttttcaag
gctgaccagcaaagcagatacatcatgatcagtaaggacaccacagcaaaggaagtggtc
atccaggccatcagagagtttgctgttactgccaccccagagcagtattccctctgtgag
gtctcggtcacgccagagggagttatcaaacaacgaaggctcccagatcaactttccaag
cttgctgacagaatacagctgagcgggaggtattatctgaaaaacaacatggaaacagaa
acgctttgctcagatgaagatgcccaggagctgttgcgagagagccaaatttcacttctt
cagctcagcactgtggaggtcgccacacagctctccatgaggaactttgaactcttccgc
aacattgagcctactgaatacatagatgatttatttaaactcaaatcaaaaaccagctgt
gccaacctaaagaaatttgaggaagtcattaaccaggaaacattttgggtggcttctgaa
attctccgagagacaaaccagctgaagagaatgaagatcattaagcatttcatcaagatt
gccttgcactgtagggaatgcaagaattttaactccatgtttgcaatcatcagtggccta
aacctggcaccagtggcaagactacggaccacctgggaaaaacttcccaataaatatgaa
aagctcttccaggacctacaagacctgtttgatccttccagaaacatggctaagtatcgc
aatgtcctgagtggccagaacttacagcctcctgtcattcccctattccccgtcatcaag
aaggacctcacgtttctccatgagggaaatgactcaaaagtagatgggctggtcaacttt
gagaagctgaggatgattgcaaaggaaatccgtcatgttggccgaatggcctcagtcaac
atggaccctgcccttatgttcagaactcggtcgctgagtcagggcagtgcgaatgccaca
gtgctggatgttgctcagacaggcgggcataaaaagcgggtacgccgtagttccttcctc
aatgccaaaaagctgtatgaagatgcccaaatggctcggaaagtgaagcaatacctgtcc
aacctggagctggagatggacgaggagagtcttcagacactgtcacttcagtgtgaacca
gcaaccagcacattgcccaagaaccctgcagacaggaagcctgtcaagtccgagacctcc
ccagtggctccacgtgcagggccccagcagaaagcgcagcctcagcagccgttggcaccc
cctcaaccatcgcataaagtcagccaggggctgcaggtgcctgctgtgtccctctacccc
tcacgaaagaaggtgccagtgaaggatctgccgccctttggcataaactctccacaagct
ttaaagaaaatcctgtccttgtctgaagaagggagtttggagcgtcataggaagcaagca
gaagacacaatatcaaacgcatcctcacagctctcatcaccccccacctcacctcagagc
tctccaaggaaagggtatgcattggctctcagtgggactgtggataatttctcagattct
ggtcacagtgagatttcttcacgatccagtattgtcagcaattcttcttttgactcggtg
ccagtctctctgcatgatgaacggcgccagaggcattctgtcagcattgtggagagcaac
ctaggggtgggcaggatggagcggcggaccctgatggagcctgatcaatacagcctagga
tcatatgccccagtgtctgaaagtcgaggcctgtatgccgcagcgacagtcatctcttct
cctagcacagaggagctttcccacgaccaaggggaccgtgcttctctcgatgctgctgac
agcggtcgggggagctggacatcatgctcaagtggttctcatgacaacatacagaccatc
cagcaccagagaagctgggaaacactgccatttgggcacactcactttgactattcaggg
gatgcgacaggtatatgggcctccggcggccatatggaccaaatcatgttttctgatcat
agcacaaaatataatagacagaatcagagtagagagagtcttgaacaagcccaatcccgg
gcaagctgggcgtcttccacgggctactggggagaagactcagaaggcgacacgggcact
atcaagcgaaggggtgggaaggatgtctccactgaggcagagagcagcagcatggtgcct
gtgactacagaggaagctaagcctgtccctatgcctgcccacatagccgtgacgcccagc
actaccaagggactcatcgcacgaaaggaaggcaggtaccgggagccgcctcccacacct
ccaggctacgtgggcattcccattgccgatttcccagaagggccttgccaccccgccagg
aagcccccggattacaacgtggccctgcagcggtcccgcatggtggcacggcccactgag
gcccccgcaccaggccagacgccgccggcagccacagccagccggccgggcagcaaaccg
cagtggcacaagcccagcgacgcagacccacgcctcgcgcccttccagccgcagggcttc
gccggagcggaggaggacgaagatgaacaagtgtctgctgtttga

DBGET integrated database retrieval system