KEGG   Rattus norvegicus (rat): 303167Help
Entry
303167            CDS       T01003                                 

Gene name
Trim58, RGD1566174
Definition
(RefSeq) tripartite motif-containing 58
  KO
K12027  tripartite motif-containing protein 58 [EC:2.3.2.27]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    303167 (Trim58)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     303167 (Trim58)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRIM/RBCC proteins
    303167 (Trim58)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PRY zf-C3HC4_4 SPRY zf-B_box zf-RING_UBOX zf-C3HC4 zf-C3HC4_2 zf-RING_2 zf-RING_6 zf-C3HC4_3 zf-RING_10 zf-RING_5 Trm112p Terminase_GpA DUF3844 zf-RING_4 DUF885
Motif
Other DBs
NCBI-GeneID: 303167
NCBI-ProteinID: NP_001178570
RGD: 1566174
Ensembl: ENSRNOG00000026430
UniProt: D3ZYF5
Position
10q22
AA seq 485 aa AA seqDB search
MATAPGERLQEEARCSVCLDFLQEPISVDCGHSFCLRCISELCEKSDSAQGVYACPQCRG
PFRPSSFRPNRQLASLVDTVRQLGLGTGHAGSRQCSRHGEDLSHFCEEDQAMVCWVCDTS
PEHRSHRTEPLQEAASRYQRMLQVALELVKKEMEEALTQEANVGKKTIIWKEKVEMQRQR
FRLEFEKHRGFLAQEEQLQLRRLEEEERATLQRLRDSRNRLAQQNKALKELAEELEEMSQ
RPAVALLEGARGVLTRSEAMTRLEPEAVPMELKTVCRIPGMREMLRKFQVDVKLDPATAH
PSLLLTTDLRSVQDAEVWRDVPSNPERFDTWPCILGLQGFSSGRHYWEVIVGERAEWGLG
VCQDSVLRKGETTPSPENGVWAMWLLRGSEYMVLSSPSVPVFQDERPRRIGIFLDYEAGQ
ISFYNVTNGSYIYTFNHLFSGVLRPYFFVCDTTPLILPPMTEAGPGNWTSRGLLDFAVAA
RSEEY
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atggccacagcacccggggagcggctgcaggaggaggcacggtgctcagtgtgcctggac
ttcctgcaggagcccatcagcgttgactgtggtcacagcttctgtctgcggtgcatatct
gagctctgcgagaaatcggacagcgctcagggagtctatgcttgtccccagtgcaggggt
cccttcaggccctccagcttcagacccaaccggcagctggccagcctggtggacaccgtg
cggcagctggggctgggcaccggacacgcggggtcgcgtcagtgttcgaggcacggtgag
gacctgagccacttctgtgaagaggaccaagcgatggtgtgctgggtctgcgacaccagc
cctgagcaccggagccaccgcactgagccgctgcaggaggcagccagccgctaccagagg
atgctccaagtggctttggaacttgtgaagaaggaaatggaggaggctctgacccaggag
gccaacgtgggaaagaagaccatcatctggaaggagaaagtggagatgcagagacaacgt
ttcaggctggagtttgagaaacaccggggctttctggcccaggaggagcagctgcagctg
aggcgactggaagaggaggagcgagcaaccctgcagagactgcgtgacagtaggaacagg
ctggcccaacagaacaaagccctgaaggaactggctgaagagctggaggagatgagtcag
aggccagcggtagcactgctggagggagcgagaggagtcttgacgcgaagcgaagctatg
accaggctggaaccagaggctgtccctatggagctgaagaccgtgtgccgcatccctggg
atgagggagatgctgaggaagttccaagtggacgtgaaactcgatcccgccactgcccac
ccaagcttgctcttaacgacggatctgcgcagtgtgcaggatgcggaggtctggagggat
gtcccgagcaaccctgagcgctttgacacctggccctgcatcctgggcctgcagggcttc
tcctccgggaggcattactgggaagtcatcgtgggggaaagagcagagtgggggctaggg
gtctgccaagactcagtgcttagaaaaggggagaccacaccgtccccagagaatggtgtc
tgggccatgtggctcctgagggggagcgagtacatggtcctgtcctctccctcggtgcct
gtgttccaagatgagcgacctcgtcgcatcgggatctttttggactacgaagccggccaa
atctccttctacaatgtcacaaatgggtcttacatctacacatttaaccatctcttctcc
ggtgttctcaggccctatttcttcgtctgtgacacaactcctcttatcttgccacccatg
acagaagcaggacctggaaactggacttccaggggtctccttgattttgctgttgctgcc
agaagtgaggaatactaa

DBGET integrated database retrieval system