KEGG   Rattus norvegicus (rat): 303175Help
Entry
303175            CDS       T01003                                 

Gene name
Hist3h2ba
Definition
(RefSeq) histone cluster 3, H2ba
  KO
K11252  histone H2B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05034  Alcoholism
rno05203  Viral carcinogenesis
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    303175 (Hist3h2ba)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    303175 (Hist3h2ba)
  09165 Substance dependence
   05034 Alcoholism
    303175 (Hist3h2ba)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    303175 (Hist3h2ba)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    303175 (Hist3h2ba)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    303175 (Hist3h2ba)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   303175 (Hist3h2ba)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like
Motif
Other DBs
NCBI-GeneID: 303175
NCBI-ProteinID: NP_001104597
RGD: 1307520
Ensembl: ENSRNOG00000043419
UniProt: D3ZNZ9
Position
10q22
AA seq 126 aa AA seqDB search
MPEPSRSTPAPKKGSKKAITKAQKKDGKKRKRGRKESYSIYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIASEASRLAHYNKRSTITSREVQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgccggaaccttcccgctccactcccgcgccgaagaagggttccaagaaagccatcacc
aaggcacagaaaaaggatggcaagaaacgcaaacggggccgcaaggagagctactccatc
tacgtgtacaaggtgctgaagcaggtgcacccggacaccggcatctcgtccaaggccatg
ggcatcatgaactcgttcgtcaacgacatcttcgagcgcatcgccagcgaggcctcccgc
ctggctcattacaacaagcgctcgaccatcacgtcccgcgaggtgcagacggccgtgcgc
ctgctgctgcctggggagctggccaagcatgccgtgtcggaaggcaccaaggcagtcacc
aagtacaccagttccaagtga

DBGET integrated database retrieval system