KEGG   Rattus norvegicus (rat): 303180Help
Entry
303180            CDS       T01003                                 

Gene name
RGD1304587, Mmtag2
Definition
(RefSeq) similar to RIKEN cDNA 2310033P09
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: MMtag GAGA_bind Hydin_ADK RR_TM4-6 AAR2 Neur_chan_memb SAPS
Motif
Other DBs
NCBI-GeneID: 303180
NCBI-ProteinID: NP_001094021
RGD: 1304587
Ensembl: ENSRNOG00000002944
UniProt: Q5M9I6 B1WC47
Position
10q22
AA seq 260 aa AA seqDB search
MFGSSRGGVRGGQDQFNWEDVKTDKQRENYLGNSLMAPVGRWQKGRDLTWYAKDRAPCTG
PSREEELAAVREAEREALLAALGYKNVRKQPTGLSKEDFVEICKREGGDPEEKGVDRLLG
LGSASGSAGRVALSREDKEAAKLGLSVFTHHRVDSEGPSTAPSATRKKPRAEDKAELDAE
SHKKSKKEKKKKKKKHKKHKKKKDKEHKREADSCSSSPSPARPRRQRHSDFSPCYKRKRE
HSQDSGRNPSHRRQDRSSDD
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgttcggctccagtcgcggcggcgtgcgtggcgggcaagaccagttcaattgggaagat
gtgaagactgacaagcagagggagaactacctgggcaactcgctgatggcaccagtaggc
cgctggcagaagggccgcgacctcacctggtacgcgaaggaccgcgcgccgtgtaccggc
ccgagccgtgaagaagaattggcagccgtgcgtgaggcggagcgtgaggcgctgctggcc
gcacttggttacaagaacgtgaggaaacagcccaccggcctgagcaaggaggacttcgtg
gagatctgcaaacgggaaggaggagatcctgaggagaagggtgtggaccggctgctgggt
ctgggcagcgccagtggctccgcgggccgtgtggcactatcccgagaagacaaagaggct
gccaaacttgggctgtcagtgttcacgcaccaccgtgtggacagcgaaggcccaagtact
gccccatctgctaccaggaagaagccccgtgctgaagacaaggctgaactggatgcagag
agccataagaaaagcaagaaagaaaagaagaaaaagaagaagaaacataagaaacacaaa
aagaagaaagacaaagaacacaagagggaggctgacagctgctcatcttctccctctcct
gcccggcccagacgccagagacattctgacttctctccctgctataagaggaagcgggaa
catagccaggacagtggaaggaacccatcccacagacgacaagacagaagttctgatgac
tga

DBGET integrated database retrieval system