KEGG   Rattus norvegicus (rat): 303196
Entry
303196            CDS       T01003                                 

Gene name
Tmem11, RGD1309817
Definition
(RefSeq) transmembrane protein 11
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: Mito_morph_reg
Other DBs
NCBI-GeneID: 303196
NCBI-ProteinID: NP_001158015
RGD: 1309817
Ensembl: ENSRNOG00000005377
UniProt: B0BN86
Position
10q22
AA seq 190 aa
MAAWGRRRLGPGGGSSRERVSLSATDCYIVHEIYSGENAQDQFEYELEQALEAQYKYIVI
EPTRIGDETARWITVGNCLHKTAVLAGTACLFTPLALPLDYSHYISLPAGVLSLACCTLY
GISWQFDPCCKYQVEYDAYKLSRLPLHTLTSSTPVVLVRKDDLHRKRLHNTIALAALVYC
VKKVYELYAV
NT seq 573 nt   +upstreamnt  +downstreamnt
atggccgcgtggggaaggaggcgtctgggtccgggcggcggcagctcccgagagagggtt
agcctgtcagctacagattgctacattgtgcatgagatctacagtggggagaatgcccag
gaccagtttgagtatgagctggagcaggcgctggaagcccagtacaagtacattgtgata
gagcccacccggattggagacgagacagcacgctggatcaccgtaggcaattgcctgcac
aagacggccgtgttggcaggtactgcctgcctcttcaccccattggcactgcccctggat
tactcccactacatctccctgcccgctggtgtgctgagcctggcctgctgtaccctctat
gggatctcctggcagtttgacccttgctgcaagtaccaggtggagtatgatgcctataaa
ctgtcccgcctgcctctgcacacgctcacctcctccacaccagtggtgctggttcggaag
gacgacctgcacagaaagagactgcacaacacaatagccctggctgccctggtgtactgt
gtaaagaaggtttatgagctctacgccgtatga

DBGET integrated database retrieval system