KEGG   Rattus norvegicus (rat): 303206
Entry
303206            CDS       T01003                                 

Gene name
Ulk2
Definition
(RefSeq) serine/threonine-protein kinase ULK2
  KO
K08269  serine/threonine-protein kinase ULK2 [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04136  Autophagy - other
rno04140  Autophagy - animal
rno04150  mTOR signaling pathway
rno05010  Alzheimer disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    303206 (Ulk2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    303206 (Ulk2)
   04136 Autophagy - other
    303206 (Ulk2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    303206 (Ulk2)
   05014 Amyotrophic lateral sclerosis
    303206 (Ulk2)
   05016 Huntington disease
    303206 (Ulk2)
   05017 Spinocerebellar ataxia
    303206 (Ulk2)
   05022 Pathways of neurodegeneration - multiple diseases
    303206 (Ulk2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    303206 (Ulk2)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    303206 (Ulk2)
   03029 Mitochondrial biogenesis [BR:rno03029]
    303206 (Ulk2)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     303206 (Ulk2)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: Other
  ULK family [OT]
   303206 (Ulk2)
Membrane trafficking [BR:rno04131]
 Autophagy
  Autophagosome formation proteins
   Atg1 complex
    303206 (Ulk2)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    303206 (Ulk2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr DUF3543 Kdo ABC1 RIO1 Pkinase_fungal Kinase-like APH DUF5898
Other DBs
NCBI-GeneID: 303206
NCBI-ProteinID: NP_001178574
RGD: 1310181
Ensembl: ENSRNOG00000002763
UniProt: D3Z9J7
Position
10
AA seq 1037 aa
MEVVGDFEYSKRDLVGHGAFAVVFRGRHRQKTDWEVAIKSINKKNLSKSQILLGKEIKIL
KELQHENIVALYDVQELPNSVFLVMEYCNGGDLADYLQAKGTLSEDTIRVFLHQIAAAMR
ILHSKGIIHRDLKPQNILLSYASRRKSNVSGIRIKIADFGFARYLHSNTMAATLCGSPMY
MAPEVIMSQHYDAKADLWSIGTVIYQCLVGKPPFQANSPQDLRMFYEKNRSLMPSIPRET
SPYLANLLLGLLQRNQKDRMDFEAFFSHPFLEQVPVRKSCPVPVPVYSGPGPGSSCSSSP
PCRFASPPSLPDMQHIQEENLSSPPLGPPNYLQVSKDSASNSSKNSSCDTDDFVLVPHNI
SSDHSYDMPMGTAGRRASNEFFVCGGQCQPTVSPHSETAPIPVPTQVRNYQRIEQNLIST
ASSGTNPHSSPRSAVVRRSNTSPMGFLRVGSCSPVPADTVQTGGRRLSTGSSRPYSPSPL
VGTIPEQFSQCCCGHPQGHEARSRHSSGSPVPQTQSPQSLLLGARLQSAPTLTDIYQNKQ
KLRKQHSDPVCPSLAGAGYSYSPQPSRPGSLGTSPTKHMGSSPRSSDWFFKTPLPTIIGS
PTKTTAPFKIPKTQASSNLLALVTRHGPAESQSKDGNDPRQCSHCLLVQGSERHRSEQQS
KAVFGRSVSTGKLSEQQHVKAPLGGHQGSTDSLNTERPMDVAPAGACGVVLALPAGTAAS
ARAVLFTVGSPPHSATAPTCTHMVLRTRTTSVGSNSSGGSLCSASGRVCVGSPPAPGFGS
SPPGAEAAPSLRYVPYGASPPSLEGLITFEAPELPEETLMEREHTDTLRHLNMMLMFTEC
VLDLTAVRGGNPELCTSAVSLYQIQESVVVDQISQLSKDWGRVEQLVLYMKAAQLLAASL
HLAKAQIKSGKLSPSTAVKQVVKNLNERYKFCITMCKKLTEKLNRFFSDKQRFIDEINSV
TAEKLIYNCAVEMVQSAALDEMFQQTEDIVQRYHKAALLLEGLSKILQDPADAESVHKYK
CSIERRLSALCCSTAAV
NT seq 3114 nt   +upstreamnt  +downstreamnt
atggaggtggtgggcgacttcgagtacagcaagcgggacctcgtgggacacggggccttc
gctgtggtcttccgggggcggcaccgccagaaaactgattgggaggtggctattaaaagt
attaataaaaagaacttgtcaaagtcacaaattctgcttggaaaggaaataaaaatctta
aaggaacttcagcatgaaaatatcgtagcactctatgatgttcaggaattacccaactct
gtctttctggtgatggagtattgcaatggtggagatctggcagattatttgcaagctaaa
ggaactctgagtgaagatactatcagagtgtttcttcatcagattgcagcagccatgcga
atcctgcacagcaaagggataatccacagggatctcaaaccacagaacatcttgttgtct
tacgccagtcgaaggaagtcgaatgtcagtggtattcgcatcaaaatagctgactttggt
tttgcccgttacctacatagtaacacaatggcagcgacactgtgtggatccccaatgtac
atggctcctgaggttatcatgtctcaacattatgatgctaaggcagatttatggagcata
ggaacggtgatctatcaatgcctagttggaaaaccaccttttcaggctaacagtcctcaa
gacctaaggatgttttatgaaaaaaacaggagcttaatgcctagtattcccagagaaaca
tcaccttatttggctaatctccttttgggcttgcttcaaagaaatcagaaggacagaatg
gactttgaagcgtttttcagtcatcctttccttgagcaagttccagttagaaaatcttgc
ccagtcccagtgcctgtgtactccggccctggccctggaagctcctgcagcagctcgcca
ccttgtcgctttgcttctccaccatcccttccagatatgcagcatattcaggaagaaaac
ttatcctccccaccattgggtcctcccaactatctacaggtgtccaaagattctgccagt
aatagtagcaagaactcttcttgtgacacggatgactttgttttggttccacacaacatc
tcgtcagaccactcatatgatatgccaatggggactgctggcagacgggcttcaaatgag
ttctttgtgtgtggagggcagtgtcaacctactgtgtcacctcacagcgaaacagcccca
attccagttcctactcaagtaaggaattatcagcgcatagaacagaatcttatatccact
gccagctctggtacaaatccacatagttctccaagatctgcagtggtacgaaggtctaat
accagccccatgggcttcctccgggttgggtcctgctcccctgtaccagcagacacagtg
cagacgggaggacgaagactctcgaccggctcttccaggccttactcaccatcccctttg
gttggtactattcctgaacagtttagtcagtgctgctgtggacatcctcagggccatgaa
gccaggagtagacactcctcaggttctccagtgccacagacccagtcaccacagtcactc
ttactgggtgctagactgcagagtgcacccaccctcaccgatatctatcagaacaagcag
aagctcagaaagcagcactctgaccctgtgtgtccatcccttgccggggctggatatagt
tactcacctcagccgagtcggcctggcagccttggaacctctcccaccaagcatatgggg
tcctctccacggagttctgactggttctttaaaactcctttaccaacaatcattggctct
cctactaagactacagctcctttcaaaatccctaaaacacaagcatcttctaacctgtta
gccttggttactcgtcatggacctgctgaaagccagtccaaagatggaaatgaccctcgt
cagtgttcacattgcctcttagtacaaggaagtgagaggcatcgatctgagcagcagagc
aaggcggtatttggcagatctgtcagtaccgggaagttgtcagaacaacagcacgtaaag
gcacctttaggtggacaccagggcagcacagatagtttaaacacagaacgaccaatggat
gtagctccagcaggagcctgtggtgttgtgttggcattgccagcaggaacagcagcaagc
gccagagctgtcctcttcaccgtggggtctcctccacacagtgccacagcccctacttgt
actcacatggtccttcgaacaagaaccacctcagtggggtccaacagctcaggaggctcc
ttgtgttctgcgagtggccgagtgtgtgtgggctcccctcctgcgccagggttcggctcc
tccccaccaggagcagaggcagctcccagcctaagatacgtgccttacggtgcttcacca
cccagcctagagggtctcatcacctttgaagcccctgaactaccagaggagacactgatg
gagcgagaacacacagacaccttacgtcatctgaacatgatgctgatgtttactgagtgt
gtgctggacctgacagcagtgaggggtgggaaccctgagctgtgcacatctgctgtgtcc
ctgtatcagattcaggagagtgtagttgtggaccagataagccagctaagcaaagattgg
gggcgggtagagcagctggtgttgtacatgaaggcggcacagctgctggcggcttccctg
catctcgccaaagctcagatcaagtccgggaagctgagcccatccacggctgtgaaacaa
gttgttaaaaatctgaatgaaagatataaattctgcatcaccatgtgcaagaaacttaca
gaaaagctgaatcgcttcttctctgataaacagagatttattgatgaaatcaacagtgtg
actgcagagaaactcatctataattgtgctgtggaaatggttcagtctgcagccctggat
gagatgttccagcagactgaagacatcgttcagcgataccacaaggcagcccttcttttg
gaaggcttaagtaagatcctgcaggaccctgcagatgctgagagtgtgcataagtataaa
tgtagtattgaaagaagattgtcagcgctctgctgtagcactgcagctgtgtga

KEGG   Rattus norvegicus (rat): 360827
Entry
360827            CDS       T01003                                 

Gene name
Ulk1
Definition
(RefSeq) serine/threonine-protein kinase ULK1
  KO
K21357  serine/threonine-protein kinase ULK1 [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04137  Mitophagy - animal
rno04140  Autophagy - animal
rno04150  mTOR signaling pathway
rno04152  AMPK signaling pathway
rno04211  Longevity regulating pathway
rno05010  Alzheimer disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    360827 (Ulk1)
   04150 mTOR signaling pathway
    360827 (Ulk1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    360827 (Ulk1)
   04137 Mitophagy - animal
    360827 (Ulk1)
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway
    360827 (Ulk1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    360827 (Ulk1)
   05014 Amyotrophic lateral sclerosis
    360827 (Ulk1)
   05016 Huntington disease
    360827 (Ulk1)
   05017 Spinocerebellar ataxia
    360827 (Ulk1)
   05022 Pathways of neurodegeneration - multiple diseases
    360827 (Ulk1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    360827 (Ulk1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    360827 (Ulk1)
   03029 Mitochondrial biogenesis [BR:rno03029]
    360827 (Ulk1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     360827 (Ulk1)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: Other
  ULK family [OT]
   360827 (Ulk1)
Membrane trafficking [BR:rno04131]
 Autophagy
  Autophagosome formation proteins
   ULK complex
    360827 (Ulk1)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    360827 (Ulk1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr DUF3543 Kdo ABC1 RIO1 Pkinase_fungal Kinase-like APH
Other DBs
NCBI-GeneID: 360827
NCBI-ProteinID: NP_001101811
RGD: 1589743
Ensembl: ENSRNOG00000037505
UniProt: D3ZMG0
Position
12
AA seq 1051 aa
MEPGRGGVETVGKFEFSRKDLIGHGAFAVVFKGRHREKHDLEVAVKCINKKNLAKSQTLL
GKEIKILKELKHENIVALYDFQEMANSVYLVMEYCNGGDLADYLHTMRTLSEDTVRLFLQ
QIAGAMQLLHSKGIIHRDLKPQNILLSNPGGRRANPSNIRVKIADFGFARYLQSNMMAAT
LCGSPMYMAPEVIMSQHYDGKADLWSIGTIVYQCLTGKAPFQASSPQDLRLFYEKNKTLV
PAIPRETSAPLRQLLLALLQRNHKDRMDFDEFFHHPFLDASTPIKKSPPVPVPSYPSSGS
GSSSSSSSASHLASPPSLGEMPQLQKTLTSPADAAGFLQGSRDSGGSSKDSCDTDDFVMV
PAQFPGDLVPEAASAKPPPDSLLCSGSSLVASAGLESHGRTPSPSPTCSSSPSPSGRPGP
FSSNRYGASVPIPVPTQVHNYQRIEQNLQSPTQQQTARSSAIRRSGSTSPLGFGRASPSP
PSHTDGAMLARKLSLGGGRPYTPSPQVGTIPERPSWSRVPSPQGADVRAGRSPRPGSSVP
EHSPRTTGLGCRLHSAPNLSDFHVVRPKLPKPPTDPLGATFSPPQTSAPQPCPGLQSCRP
LRGSPKLPDFLQRSPLPPILGSPTKAGPSFDFPKAPSSQSLLTLLARQGVVMTPPRNRTL
PDLSEAGPFQGQQLGSGLRPAEDTRGPFGRSFSTSRLTDLLLKAAFGTQASDSGSTDSLQ
EKPMEIAPSAGFGGTLHPGARAGGASSPAPVVFTVGSPPSGTTPPQSTRTRMFSVGSSSS
LGSTGSSSARHLVPGACAEAPELSAPGYCCSLADPLAANLEGAVTFEAPDLPEETLMEQE
HTETLHSLRFTLAFAQQVLEIAALKGSASEAAGGPEYQLQESVVADQISQLSREWGFAEQ
LVLYLKVAELLSSGLQTAIDQIRAGKLCLSSTVKQVVRRLNELYKASVVSCQGLSLRLQR
FFLDKQRLLDGIHGVTAERLILSHAVQMVQSAALDEMFQHRESCVPRYHKALLLLEGLQH
TLTDQADIENIAKCKLCIERRLSALLSGVYA
NT seq 3156 nt   +upstreamnt  +downstreamnt
atggagccgggccgcggcggcgtcgagaccgtgggcaagttcgagttctctcgcaaagac
ctgattggacacggcgccttcgcggtggtcttcaagggtcgacaccgcgagaagcacgac
ctggaggtggccgtcaaatgcattaacaagaagaaccttgccaagtcccagacactgcta
ggaaaggaaatcaaaatcctgaaggaactaaagcacgaaaacattgtggcgttgtatgac
ttccaggagatggccaattctgtctacctggtcatggagtattgtaatggtggagacctg
gctgactacctgcacactatgcgcacactgagtgaagacactgtcaggctgttcctacaa
cagattgcaggtgccatgcagctgctacacagcaagggcatcattcaccgtgatttgaag
ccccagaacatcctgctgtccaatcccgggggtcgacgtgccaaccccagcaacatccga
gtcaagattgctgactttggatttgcccggtacctccagagcaacatgatggcggccacg
ctctgtggctctcctatgtacatggcccctgaggttatcatgtcccagcactacgatggg
aaggctgacctgtggagcattggcaccattgtctaccagtgtctgacagggaaggcccct
tttcaggccagcagccctcaggatttgcgcctgttttatgagaagaacaagacactagtt
cctgccatcccacgggagacatcagctcccctgcggcagttgcttctggctctattgcag
cgtaaccacaaggaccgcatggactttgatgaatttttccaccaccctttcttagatgcc
agcacccccatcaagaaatccccacctgtgcctgtgccctcatatccaagctcagggtcc
ggcagcagctccagcagcagctctgcctcccacctggcatctcccccgtccctgggggag
atgccgcaactgcagaagacccttacctccccagctgatgctgctggctttctgcagggg
tcccgggactctggtggcagtagcaaagactcctgtgacacagatgactttgtcatggtc
ccagcccagtttccaggtgatctagtccctgaggcagccagtgccaagcccccacctgac
agtctgctgtgtagtgggagctcactggtggcctctgctggcctagagagccatggccgt
accccatctccctctccgacctgcagcagctctcccagcccctctggccggcctggcccc
ttctccagcaacaggtacggtgcctcggtccccattcctgtccccactcaggtgcacaac
taccagcgcatcgagcagaacctgcagtcacctactcaacagcagacagcccggtcttct
gccatccgaaggtcaggtagcaccagccccctgggctttggtcgggccagcccatcacct
ccctcgcacactgatggagccatgctggccaggaagctgtcactaggaggtggccgtccc
tacacaccctctccccaagtgggaaccatcccagagcggcccagctggagcagagtaccc
tccccacaaggagctgatgtgcgggctggcaggtcaccacgaccaggctcctctgtgcct
gagcactctccacgaaccaccgggctgggctgccgcctgcacagtgcccccaacctttcg
gacttccatgtcgttcgtcccaagctgcctaagcctccaacagacccactgggagctacc
ttcagcccaccccagaccagcgcaccccagccatgcccagggctacagtcttgccggcca
ctgcgtggctcacctaagctgcctgacttcctacagcggagtcccctaccccccatccta
ggctctcctactaaggctggaccctcgtttgacttccccaaagcccccagctctcagagt
ttgctgaccctgttggctaggcagggtgtagtaatgacaccacctcggaaccgtacactg
cctgacctctcagaggcgggtcctttccagggccagcagctgggctctggcctacggccc
gccgaagacacaaggggcccctttggccggtccttcagcaccagccgccttacggacctg
ctgcttaaggctgcatttgggacacaggcctctgactcaggcagcactgacagcctacag
gagaaacctatggagattgctccctctgctggttttggagggactctgcatccaggagct
cgtgctggaggggcaagcagcccagcacctgtggtatttactgtgggctccccacccagt
ggtaccaccccaccccagagtacccgcaccagaatgttctcagtgggctcttccagctcc
ctgggctcgactggctcctcctctgcccgccacttagtgcctggggcttgtgcagaggcc
ccggagctttctgccccaggctactgctgtagccttgctgacccccttgctgccaacttg
gagggggctgtgaccttcgaggctcctgacctcccagaggagaccctcatggagcaagag
cacacggaaaccctacacagcctgcgcttcacactagcgtttgcacagcaagttctggag
attgcagccctgaagggcagtgccagtgaggcagccgggggccctgagtaccagcttcag
gaaagtgtggtggctgaccagatcagtcagttgagccgagagtggggctttgcagagcaa
ctggttctgtacttgaaggtggctgagctgctctcttcaggcttacagactgccattgac
cagattcgagctggcaagctctgcctttcgtctactgtgaagcaggtggtacgcagacta
aatgagctgtataaggccagcgtggtatcctgccagggcctcagtctgcggcttcagcgc
ttctttctggacaagcaacggctgctggatgggatccatggtgtcactgcagagcggctt
atcctcagccatgctgtgcagatggtacaatcagctgcactcgatgagatgttccagcac
cgagagagctgtgtacctcgatatcacaaagccctgctgttgttggaggggctgcagcac
actctcacggaccaggcagacattgagaacattgccaaatgcaagctgtgcattgagagg
agactctcggccctgctgagtggcgtctatgcctga

DBGET integrated database retrieval system