KEGG   Rattus norvegicus (rat): 303211
Entry
303211            CDS       T01003                                 

Gene name
Mmgt2
Definition
(RefSeq) membrane magnesium transporter 2 precursor
  KO
K23566  membrane magnesium transporter 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    303211 (Mmgt2)
Membrane trafficking [BR:rno04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Others
   ER membrane protein complex
    303211 (Mmgt2)
SSDB
Motif
Pfam: MMgT
Other DBs
NCBI-GeneID: 303211
NCBI-ProteinID: NP_001013989
RGD: 1311260
UniProt: Q6P719
Position
10
AA seq 124 aa
MVAWLWKVLVGVGLSALAHAAFSAAQHRSHMRLAEMKYEPLPTDIVLQTLLAFALTCYGV
VHTAGDFRDRDATSELKNVTFDTLRNRPSFYVFQHSGSSLLQPSDTTRSSNLNVPSSDDI
RLKF
NT seq 375 nt   +upstreamnt  +downstreamnt
atggtggcgtggctgtggaaggtgctggtgggcgttggtctctccgccctcgcccatgct
gccttttcggctgcacagcatcgttctcacatgaggctggcagaaatgaagtatgagccg
ctgccgaccgatatagttcttcagacacttttggcctttgcccttacctgttatggcgta
gttcatactgcaggggactttagagaccgggatgccacttcagaactaaagaatgtgaca
tttgacaccttaaggaatcgcccgtctttttatgtgtttcaacattctggttccagtctt
ctccagccttcggatacaactcgttcttcaaacctcaacgtgccatcttccgatgacata
cggttgaagttttga

DBGET integrated database retrieval system