KEGG   Rattus norvegicus (rat): 303214Help
Entry
303214            CDS       T01003                                 

Gene name
Trim16
Definition
(RefSeq) tripartite motif-containing 16
  KO
K12006  tripartite motif-containing protein 16
Organism
rno  Rattus norvegicus (rat)
Brite
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRIM/RBCC proteins
    303214 (Trim16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PRY SPRY zf-B_box
Motif
Other DBs
NCBI-GeneID: 303214
NCBI-ProteinID: NP_001128505
RGD: 1309749
Ensembl: ENSRNOG00000003219
UniProt: D3ZW47
Position
10q23
AA seq 557 aa AA seqDB search
MAELDLIAPGPLTGVTVHPLAPLGPDPGSAIPIGKEDVDLLSKPGEETQGQGDLAKLGAP
GDEEEGQILCDFCLGASRVRAVKSCLTCMVNYCEEHLRPHQENSKLHSHQLTEPTKDQDL
RTCPAHHSPLVSFCHTHQQCICQECGTGEHRGDSTVSLDAARRSKEADLRCMQLDLEQKL
KLNENAIARLQANHKSVLVSVSEVKVVAEEKFGELLAAVRKAQTDVMLFLEEKEQAALNQ
VNGIKTHLEHRSIEMEKNKQELEKLASISNTVLFLEEYCKLKKTEDTAFPSVYIGLKDKL
SGIRKVITESTLNLIQLLESYKEKLQEFSREEEYDIRTQVSAIVQRKYRTSKPEPRTRDE
FLQYACDITFDPDTAHRYLRLQEDNRKVTNTTPWEHPYPDLPSRFLHWRQVLSQQSLYLH
RYYFEVEISGGGIYVGLTCKGIDRKGEERNSCISGNSFSWSIHWSGKEFTAWHSDTETPL
KASPFRRLGIYVNFPGGTLSFYGVEYDAMTLIQKFDCKFSEPLYAAFWLSKKENTIRIVD
LGEEPEKPAVPSVEAAP
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atggctgaattggatctaattgccccagggcctctgaccggggtcactgttcaccctttg
gctcctctcggcccagaccctgggtcagctattccaataggaaaagaagatgtggacctt
ctcagcaagccaggcgaggaaacccaggggcagggtgacctcgcaaagctcggggctcct
ggtgatgaagaggagggacagatcctgtgtgacttctgtcttggggccagcagagtaagg
gctgtaaagtcctgtttgacctgcatggtgaattactgtgaggagcacctgcggccacac
caggagaacagcaaactgcacagccaccagctaaccgagcccacaaaagaccaggatctg
cgcacctgccctgcccaccacagccctttggtttccttctgccacacgcaccagcagtgt
atctgccaggaatgcggcacgggtgaacacagaggcgacagcactgtctccctggatgca
gcccgcaggagcaaagaggctgaccttcggtgcatgcagctggacctggagcagaagctc
aagttgaacgaaaatgccattgcccggctccaagccaaccacaagtctgttttggtgtcc
gtgtcagaggtgaaggtggtggctgaagagaagtttggggaactcctcgcagccgtgagg
aaggcccagactgatgtgatgctcttcttagaggagaaagaacaggctgcactgaatcag
gtcaacggcatcaagacccacctggagcacaggagcatcgagatggagaaaaacaagcag
gagctggagaagttggcctccatcagcaacactgtgctcttcctggaggagtactgcaag
cttaagaagacagaggacactgccttccccagcgtttacatcgggctgaaggataaactc
tcaggcatccgcaaggtcatcacagagtcaactctgaacttgatccagttgctagaaagc
tataaggaaaagcttcaggaattttccagggaagaagaatatgacatcagaactcaagtg
tctgccattgtccagcgcaagtacaggacctcgaaacccgagcccagaacccgggatgag
tttcttcaatatgcctgtgacatcacatttgacccagacacagcacacaggtaccttcgc
ctgcaggaggataaccgcaaggtcaccaacaccacaccctgggaacacccttacccagac
ctccccagtaggtttctgcactggcggcaggtgctgtcccagcagagtctgtacctgcac
aggtattattttgaggtggagatctctggaggaggcatctatgttggcctgacctgcaaa
ggcatcgaccgtaagggggaagaacgaaacagctgcatttctggaaacagcttctcctgg
agcattcactggagtgggaaggagttcacggcctggcacagtgacacagagactccgctc
aaggccagccccttcaggaggcttggcatctatgtaaatttcccaggaggaaccctttcc
ttctatggtgtagaatatgatgccatgactctgattcagaagtttgactgcaagttctca
gagccactctatgctgctttctggctgtctaagaaagaaaacaccatccggattgtggat
ctgggagaggagcctgagaagccagctgtaccctcagtggaggctgctccctag

DBGET integrated database retrieval system