KEGG   Rattus norvegicus (rat): 303222
Entry
303222            CDS       T01003                                 

Gene name
Arhgap44, RGD1305664
Definition
(RefSeq) Rho GTPase activating protein 44
  KO
K21067  Rho GTPase-activating protein 44
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    303222 (Arhgap44)
Membrane trafficking [BR:rno04131]
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    303222 (Arhgap44)
SSDB
Motif
Pfam: BAR RhoGAP BAR_3
Other DBs
NCBI-GeneID: 303222
NCBI-ProteinID: XP_006220759
RGD: 1305664
Ensembl: ENSRNOG00000003603
UniProt: F1LQX4
Position
10q24
AA seq 814 aa
MKKQFNRMRQLANQTVGRAEKTEVLSEDLLQVEKRLELVKQVSHSTHKKLTACLQGQQGA
EADKRSKKLPLTTLAQCLMEGSAILGDDTLLGKMLKLCGETEDELAQELIHFELRVERDV
IEPLFLLAEVEIPNIQKQRKHLAKLVLDMDSSRTRWQQTSKSSGLSSSLQPAGAKADALR
EEMEEAANRVEICRDQLSADMYSFVAKEIDYANYFQTLIEVQAEYHRKSLTLLQAVLPQI
KAQQEAWVEKPSFGKPLEEHLMISGREIAFPIEACVTMLLECGMQEEGLFRVAPSASKLK
KLKAALDCCVVDVQEYSADPHAIAGALKSYLRELPEPLMTFELYDEWIQASNIQEQDKRL
QALWNACEKLPKANHNNIRYLIKFLSKLSEYQDVNKMTPSNMAIVLGPNLLWPQSEGNIT
EMMTTVSLQIVGIIEPIIQHADWFFPGEIEFNITGSYGSPVHVNHNANYSSMPSPDMDPA
DRRQPEQARRPLSVATDNMMLEFYKKDGLRKIQSMGVRVMDTSWVARRGSSAGRKAACAP
PSMQPPAPPSELAAPLPSPLPEQVPDSPATPAPALSPSGASLQPTPERPSVSKSKELSPG
SGQKGSPGSIQGTTCPGTQLGPQPAASPSQLPADQSPHTLRKVSKKLAPIPPKVPFVQPG
TVSDQPTGQPSPVSLSPTPPSTPSPYGLSYPPGYSMASGQLSPASAPPLASPSVFTSTLA
KSRPTPKPRQRPTLPPPQPPSVSLSASSPQSTEHPMLDGMSPGESMSTDLVHFDVPSIHI
ELGSTLRLSPLEHARRHSVTDKRDSEEESESTAL
NT seq 2445 nt   +upstreamnt  +downstreamnt
atgaagaagcagtttaaccgtatgcgccagttggccaaccagacggtgggcagggcagaa
aagactgaagttctgagcgaagaccttctccaggtggagaagcgcctagagctggtgaaa
caggtgtcccacagcacacacaagaagctcaccgcttgtctgcagggtcagcaaggagca
gaggctgacaagcgctcaaaaaagctgcctttgacgacactggcccagtgcctgatggag
gggtctgcgatcctgggagatgacacacttctcgggaagatgctgaagctctgtggagag
acggaggacgagctagctcaggagctgatccactttgagctgcgagtggagagggatgtg
atcgagcccctgttcctgctggcggaggtggagattccaaatattcaaaagcaaaggaaa
catttagcaaagctggtgcttgacatggattcttcccggaccaggtggcagcagacttcc
aagtcttcagggctttccagcagccttcagcctgcgggtgccaaagccgatgccctcagg
gaggagatggaggaagctgccaatagagtggagatttgccgggaccagctttccgctgac
atgtacagttttgtggccaaagaaattgactatgcaaactactttcaaacgctaatagaa
gtgcaagctgagtaccacaggaagtcgctgacactgctgcaggctgtgttgcctcagatc
aaagcacagcaggaggcctgggtggagaagccttcctttgggaagcccctggaggagcac
ctgatgatcagcggccgtgagatcgccttccctatcgaggcgtgtgtgacgatgctgctg
gagtgtgggatgcaggaggagggcctcttccgggtagccccctcagcctccaagctgaag
aagctgaaagctgccctggactgctgtgtggtggatgtccaggagtattcagcagacccc
catgccatagcaggggctttgaagtcttatctccgagagttgccagagcctcttatgacc
tttgaactctatgatgaatggatccaggcttctaatatccaggagcaagacaagagactt
caggctctctggaatgcttgtgagaagttgcccaaggccaaccacaacaacatccgatac
ttgatcaaatttttatcaaaactgtctgaatatcaggatgtaaacaagatgactcccagt
aacatggcaatcgtcctgggacccaacctcctttggccacagtcagaggggaacatcacc
gagatgatgaccacagtttccctgcagatcgttggcatcattgagcctattattcagcat
gcagactggttcttccctggggagatagagttcaacatcacaggcagttatgggagtccg
gtccacgtgaaccacaatgccaactatagctcaatgccctccccagacatggaccctgct
gaccggcgccagccagagcaggcccgccggcccctcagtgttgccacagacaacatgatg
ctggagttttacaagaaggatggccttaggaaaatccaaagcatgggtgtgagggtcatg
gacacatcttgggtggcacgaagaggctcctctgctggtcggaaagcagcctgcgccccg
ccttccatgcagcctcctgccccaccctccgagctggctgcgcccctgccttcacccctg
ccggagcaggtcccagacagccccgccactccagctcctgcgctctctccgtcaggtgcc
agcctgcagcccacccccgagcgccccagtgtgtctaaaagcaaggaactgtcaccaggg
tctgggcagaaaggaagtccaggttccatccaggggacaacctgcccagggacgcaactg
gggccacagccggctgccagccccagccagcttcctgcagaccagagtccgcataccctc
cggaaagtttcaaagaagttggcaccaattcctcccaaggtcccctttgtgcagccaggg
actgtttctgatcagcccactggccagccatccccagtcagcctgtctcctactccacca
agcaccccatcaccctatggactgagctaccctccggggtactccatggcctctggccag
ctttctcctgcctcagctcctcccctggcctccccctctgtctttacaagcactttagcc
aaatctcggcccacccctaagccccgacagaggcccaccctaccgcctcctcagcctccc
agtgtcagcctgtcggcttcaagtccacagtccacagagcaccccatgttagacggcatg
tcgccgggggaaagcatgtctacagatcttgtccactttgatgtcccctccatccacata
gagctggggtcaacgctccgcctgagccccctggaacatgcacggcggcactcagtgact
gacaagagggactcagaagaggagtctgagagtacagccctttga

DBGET integrated database retrieval system