KEGG   Rattus norvegicus (rat): 303238Help
Entry
303238            CDS       T01003                                 

Gene name
Ctc1, RGD1563106
Definition
(RefSeq) CST telomere replication complex component 1
  KO
K23311  CST complex subunit CTC1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:rno03032]
    303238 (Ctc1)
DNA replication proteins [BR:rno03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Telomere proteins
    CST complex (animals)
     303238 (Ctc1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CTC1 CTC1_2
Motif
Other DBs
NCBI-GeneID: 303238
NCBI-ProteinID: NP_001100480
RGD: 1563106
Ensembl: ENSRNOG00000005357
UniProt: D4A261
Position
10q24
AA seq 1211 aa AA seqDB search
MAACRAQPPTSEEAWLEAAQAFIQETLCPVDEEPNEQVTRSVIDCVKETWLSQGENQDLT
LPLSYSFVSVQNLKTNQHLPCCSHLSWSDNAYQAWTRGAGPGGSVLPREQLLLLGTLVDL
LGDLEQESRSGGLYVRDNTGTLDCELIDLDLSWLGHLFLFPSWSYLPPAKRNSLGAGHLE
LWGTPVPVFPLTVSPGPLTPIPVLYPEKASYLLRYRKKCKIKELNLAGKLVHLSALMVTQ
NKRYFIMTLGELAQAGSQVSVIVQIPAQMVWHRVLRPGRAYVLTKLRITKTRGHRSCIWT
TIPSSTLMPLRPGYVQELELDVAFADAGHKPLPEPTSSRDSRGQEGLVRGSKVLHYLGTV
TDVLNESASLYILDGQLILCLAYQKIHGLRRVIRPGVCLELRDVHLLQGLGGGTTKPVLA
LCLHGTVRLQGFSCLKPQNLPSYKVHGASLYEQLVWKCQLGLPLYLWATKALEELVYKLC
PHVLRCQQFLKHSSPGKPSLGLQLLAPSWDVLIPPGSPIRHAHSEILEEPHNCPLQKYTP
LQTPYTFPTILALAEEGQHRAWATFDPRALLPFPEAFHLTSCQLNRRLAWSWLCLPSSMF
QPAPVLLGVLVASSHKGCLQLRDVRGSLPCIPLPESSQPLIDPKLIGCLVRVEKFQLVVE
REVRSSFPSWEELGMASLIQKKQARVYVQFYLADALILPVPRPTVGLEPSETASSCPEGP
QVGQSRLFLLFYKEALMKRNFCLLPGDSSRPAEPTLSFRVSGTWLCGTQKREGSGWSPPE
SLAAENKDQKVFFIFLGSSVQWFPFLYPNQVYRLVAPDSTPALFETNHSSGTPHRPLELT
DYVSCLTIQEDWTLELGSSQDIPNVLEVPRTLSESSLAHLLSDNSPNFLVSFSAEVLSRI
LCEPPLALRRIKPGNAGAIKAGVKLTVALEMEDCDYPPHLDIYIEDPHLPPPIGLLPGAR
VHFSQLEKKISRSNVVYCCFRSTTSVQVLSFPPETKASAPLPHICLAELLQGDRPPFQAT
TSCHIVYVLSLQILWVCAHCTSICPQGKCSRQDPSCPSQRAISQASIRLLVEDGTAEATV
TCRNHHVATTLGLSPSEWSNVLDRARGPGRVALQFKGPGAQTESASKTGEPLTLLLQTLC
TSPFVLRPIKLSFALERRPCDITPIEPPRLQQFQCGELPLLTRVNPRLRLVCLSLQEPEL
PSPPQASAAAS
NT seq 3636 nt NT seq  +upstreamnt  +downstreamnt
atggctgcttgccgagcacaaccacctacctccgaggaagcctggcttgaggctgcccag
gccttcatccaagagaccctttgtccagtggacgaggagcctaatgaacaggtgactcgc
tcagtaattgactgtgtgaaggagacatggctgtcccagggggagaaccaggacttaacc
ttgcccctcagctacagctttgtctcagtacagaatctgaagacgaatcagcatctccca
tgctgcagccacctgtcctggagtgacaatgcttaccaggcttggacccgaggagctggg
ccaggaggcagtgtcctgccccgggaacagctgttacttttagggacactagtagaccta
ttaggagatttggaacaagagtctaggagtggaggcctgtatgtgagagataacactgga
accttggactgtgagcttatagatctagacctttcttggttgggccatctcttcctgttc
cccagttggagttacctccctcccgccaagaggaattccttgggggcagggcacttggag
ctgtggggtacacctgtgccagtatttcctttgactgtcagtcctggccccctcacgcct
atccctgtcctctacccagaaaaggcgtcctacctgctcagatacagaaagaaatgcaaa
ataaaggagctaaatcttgctggaaaactggtccatctgagtgccctgatggtaactcag
aacaaaaggtacttcatcatgacacttggtgaattagcccaagctggcagccaggtgtcc
gtcattgtccagattcctgctcagatggtgtggcaccgagtcctccggcctggtagggcc
tatgtgctgacaaaattgcgaataaccaagacccggggtcaccgttcctgtatttggaca
accattccatcttcaactctgatgccactgagaccaggctatgtgcaagagctggagctg
gacgtagcgtttgcagacgctggccataaaccgctgcccgagcccaccagctccagagac
agcagaggccaagaggggcttgtccgaggttccaaagtcttgcattatttgggaacagtc
actgacgtgttgaacgagtctgccagcctctacattcttgatgggcagctgattctctgc
cttgcataccagaagatccatggcctcaggcgggttattcgaccaggggtctgtctggag
ctccgtgatgttcatctcctccagggcctgggtggaggaacaacaaaacctgtgctggcc
ctttgtctccatggcactgttcgcctgcaaggcttttcttgtcttaagcctcagaacttg
ccgtcctacaaagttcatggtgcctccttgtatgagcaattggtgtggaaatgtcagtta
ggacttcccttatacttatgggctaccaaggccctggaggagctggtctacaagctctgt
ccccatgtgttgagatgtcaacagttcctgaagcactcctctcctgggaagcccagcttg
ggactgcagctcctggctccctcctgggatgttcttattccacctggcagccccattcgg
catgcacacagtgagatcctggaagaaccacataactgtccccttcagaagtatactccg
ctgcagaccccctacactttccctactatacttgccctggcagaggaagggcagcacagg
gcttgggctacctttgacccaagggccctgctgcctttcccagaagcctttcacctgaca
agctgtcaactgaatcgtcgcctagcctggtcctggctctgtctgccatccagtatgttc
cagccagccccggttttacttggggtcctggtggcttcgtctcataaaggttgtctgcag
cttcgggacgtaagaggttcactgccctgtatacccttgcctgagagttcacagcccctc
attgacccaaagctcataggctgcctggtgcgggtagagaaattccagctggtagtagag
agagaagtcaggagcagcttcccttcctgggaggagctgggcatggcaagcctcatccag
aagaagcaggccagagtctatgtccagttctacctggctgatgccctgatcctgcctgtg
cccagacccactgttggtttagaaccatctgagacagcctcctcctgcccagagggaccc
caggtgggacagagccggctgttcttactgttctacaaggaggccctcatgaaacgtaac
ttttgtctccttccgggagatagttcacgacctgcagagcccaccctgagtttccgtgtg
tcaggaacttggctttgtggcacacagaagagggagggttctggatggagcccacctgag
tctctggccgcagagaacaaggaccaaaaggtcttcttcatcttccttggctcttcagtt
cagtggtttccgttcttgtacccaaaccaagtctaccggctcgtggctcctgactcaaca
ccagcgttgtttgagacaaaccattcatctggcacacctcaccgtcctctggaattgact
gactatgtgtcttgcctcactatccaagaggactggaccctggaacttgggagctctcag
gacatacctaatgtactagaggtccctagaacactgtctgagtcctcactggctcacctg
ctcagtgacaactcccccaatttcttggtgtctttctctgctgaggttttgtctcggata
ctgtgtgaaccacctctggcccttcgcaggataaaacctgggaatgctggggctattaaa
gcaggtgtgaagctaacagtagctctagaaatggaggactgtgactatccccctcacctg
gacatatatatcgaagatccacacttgcctcccccaataggactccttccaggagcccga
gtccactttagccagctggagaaaaagatttccagatccaacgttgtttactgttgcttc
cggtcaaccacttctgtgcaggtcctgagcttccccccagagaccaaagccagtgctccc
ttgccccacatctgcctggctgaacttctccaaggtgaccggcctcccttccaggccact
acctcttgccatattgtgtatgtcctgagccttcagatcctgtgggtgtgtgcccattgc
accagcatctgtccccaggggaagtgtagtcgtcaggaccccagttgtccatctcagagg
gctataagccaggccagcatcaggctcctggtagaagatggcaccgcagaagccacagtg
acctgtaggaatcatcatgtggcaacaacactaggactgagtcctagtgagtggtccaat
gtcctagatcgtgcaagggggccagggagagtggccttgcagtttaaagggccaggagcc
caaacagagtctgcaagcaaaaccggtgaacccttgaccctgctcctccagacactttgt
accagcccctttgtcctccgacccattaagctttcctttgcgcttgaaaggagaccttgt
gatattaccccaatagaaccaccccggctgcagcagttccagtgtggagagctccctctg
ctgaccagagtgaatcccaggctccgattggtctgcctttctctgcaggagccagagctc
cccagccctccacaagcttctgctgctgcttcttaa

DBGET integrated database retrieval system