KEGG   Rattus norvegicus (rat): 303244
Entry
303244            CDS       T01003                                 

Gene name
Mpdu1
Definition
(RefSeq) mannose-P-dolichol utilization defect 1
  KO
K09660  mannose-P-dolichol utilization defect 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rno01003]
    303244 (Mpdu1)
Glycosyltransferases [BR:rno01003]
 Others
  Other glycosyltransferases
   303244 (Mpdu1)
SSDB
Motif
Pfam: PQ-loop DUF1576
Other DBs
NCBI-GeneID: 303244
NCBI-ProteinID: NP_001100481
RGD: 1307699
Ensembl: ENSRNOG00000012162
UniProt: D3Z865
Position
10q24
AA seq 247 aa
MAGETDGPFKGVLVPILLPEKCYDQFFVHWDLLHVPCLKILLSKGLGLGIVAGSLLVKLP
QIFKLLGAKSAEGLSLQSVMLELVALTGTMVYSITNNFPFSSWGEALFLTLQTVTICFLV
MHYRGETVKGVAFLVCFAVVLLALLSPVMPLAVPTLLQASNVPAVVVGKLLQAATNYHNG
HTGQLSAITVFMLFGGSLARIFTSVQETGDPLMAGVFVVSSLCNGLIAAQVLFYWNAKAP
HKQKKQQ
NT seq 744 nt   +upstreamnt  +downstreamnt
atggcgggcgagactgacggaccgttcaaaggggtgctggtaccaattcttttacctgag
aaatgctatgatcaattcttcgtccactgggacttgcttcatgttccctgcctcaagatt
ctcctcagcaaaggccttgggctgggcatcgtggctgggtcacttcttgtaaagctcccc
cagatatttaaactcttgggagccaagagtgcagaaggactgagtctccagtcagtaatg
ctggagctagtggcactgactggaactatggtctacagcatcaccaacaacttccccttc
agctcttggggtgaagcactgttcctgacactacagacggttaccatctgcttcctggtc
atgcactacagaggagagaccgtgaaaggagttgctttccttgtctgctttgccgtggtc
ctgttggcgctgctttccccagtcatgcctctggctgtgcccaccctgctccaggcctcc
aatgtacctgctgtggtggtggggaagttgctccaggcagccactaactaccacaacgga
cacacaggccagctttcagccattacagtgtttatgctgtttgggggctccttggcccgg
atcttcacttctgttcaggaaactggagatcccctcatggctggagtctttgtggtctct
tctctctgcaatggccttattgctgcccaggtcctcttctactggaatgcgaaggctccc
cacaagcagaaaaagcagcagtag

DBGET integrated database retrieval system