KEGG   Rattus norvegicus (rat): 303259Help
Entry
303259            CDS       T01003                                 

Gene name
Mink1, MEKKK_6
Definition
(RefSeq) misshapen-like kinase 1
  KO
K04413  misshapen/NIK-related kinase [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    303259 (Mink1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     303259 (Mink1)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: STE group
  STE20 family
   303259 (Mink1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase CNH Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 303259
NCBI-ProteinID: NP_001258065
RGD: 1359135
Ensembl: ENSRNOG00000033508
UniProt: F1LN69
Position
10q24
AA seq 1354 aa AA seqDB search
MGDPAPARSLDDIDLSALRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTE
DEEEEIKQEINMLKKYSHHRNIATYYGAFIKKSPPGNDDQLWLVMEFCGAGSVTDLVKNT
KGNALKEDCIAYICREILRGLAHLHAHKVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDR
TVGRRNTFIGTPYWMAPEVIACDENPDATYDYRSDIWSLGITAIEMAEGAPPLCDMHPMR
ALFLIPRNPPPRLKSKKWSKKFTDFIDTCLIKTYLSRPPTEQLLKFPFIRDQPTERQVRI
QLKDHIDRSRKKRGEKEETEYEYSGSEEEDDSHGEEGEPSSIMNVPGESTLRREFLRLQQ
ENKSNSEALKQQQQLQQQQQRDPEAHIKHLLHQRQRRIEEQKEERRRVEEQQRREREQRK
LQEKEQQRRLEDMQALRREEERRQAEREQEYKRKQLEEQRQSERLQRQLQQEHAYLKSLQ
QQQQQQQQLQKQQQQQQQQQQQQQQQQILPGDRKPLYHYGRGINPADKPAWAREVEERAR
MNKQQNSPLAKTKPSSAGPEPPIPQASPSPPGPLSQTPPMQRPVEPQEGPHKSLVAHRVP
LKPYAAPVPRSQSLQDQPTRNLAAFPASHDPDPAAVPTPTATPSARGAVIRQNSDPTSEG
PGPSPNPPSWVRPDNEAPPKVPQRTSSIATALNTSGAGGSRPAQAVRARPRSNSAWQIYL
QRRAERGTPKPPGPPAQPPGPPNTSSNPDLRRSDPGWERSDSVLPASHGHLPQAGSLERN
RNRVGASTKLDSSPVLSPGNKAKPEDHRSRPGRPASYKRAIGEDFVLLKERTLDEAPKPP
KKAMDYSSSSEEVESSEDEEEEGDGEPSEGSRDTPGGRDGDTDSVSTMVVHDVEEVSGTQ
PSYGGGTMVVQRTPEEERSLLLADSNGYTNLPDVVQPSHSPTENSQGQSPPTKDGGGDYQ
SRGLVKAPGKSSFTMFVDLGIYQPGGSGDTIPITALVGGEGGRLDQLQFDVRKGSVVNVN
PTNTRAHSETPEIRKYKKRFNSEILCAALWGVNLLVGTENGLMLLDRSGQGKVYGLIGRR
RFQQMDVLEGLNLLITISGKRNKLRVYYLSWLRNKILHNDPEVEKKQGWTTVGDMEGCGH
YRVVKYERIKFLVIALKNSVEVYAWAPKPYHKFMAFKSFADLPHRPLLVDLTVEEGQRLK
VIYGSSAGFHAVDVDSGNSYDIYIPVHIQSQITPHAIVFLPNTDGMEMLLCYEDEGVYVN
TYGRIIKDVVLQWGEMPTSVAYICSNQIMGWGEKAIEIRSVETGHLDGVFMHKRAQRLKF
LCERNDKVFFASVRSGGSSQVYFMTLNRNCIMNW
NT seq 4065 nt NT seq  +upstreamnt  +downstreamnt
atgggcgacccagcccccgcccgaagcttggacgacatcgacctgtctgccctgagggac
cctgcaggaatctttgagctggtggaggtggttggcaatggaacctatggacaggtgtac
aaggggcggcacgtcaagactgggcagctggctgccattaaggtcatggatgtcacagag
gatgaggaggaagaaatcaaacaggaaatcaacatgttaaagaagtactctcaccatcgc
aatattgccacctactacggggccttcatcaagaagagccctcctgggaacgatgaccag
ctctggctggtgatggagttctgtggtgctggctcagtgaccgacctggtaaagaacacg
aaaggaaacgcgctgaaagaggattgcattgcgtacatctgcagggagattctcaggggt
cttgcccatctccatgcccacaaggtgatccaccgagatatcaagggacaaaatgtgctg
ctgacagagaatgctgaagtcaagctagtggactttggggtgagtgctcagctggaccgc
actgtggggaggcggaacactttcattgggaccccatactggatggctccagaagtcatt
gcctgtgacgagaaccccgatgccacctatgactacaggagtgacatttggtctctagga
atcacagccattgaaatggcagagggagccccccctctgtgtgacatgcaccctatgcgg
gctctcttcctcatccctcggaaccctccccccaggctcaagtcaaagaaatggtctaag
aagttcactgacttcattgacacgtgtctcatcaagacttacctgagccgaccaccaaca
gaacagttactcaaattccccttcatccgagaccagcccacggagcggcaggtccgcatc
cagctcaaggaccacattgaccgctcccggaagaagcggggggagaaagaggagacagag
tatgagtacagtggcagtgaagaggaagacgacagccatggagaggaaggcgagccaagt
tccatcatgaatgtgcctggggagtccacactccgccgagaattcctcagactccaacag
gagaataagagcaactcagaggctttaaagcagcagcagcagctgcagcagcagcagcag
cgggaccctgaggcacacatcaaacacctgctgcaccagcggcagcgtcgcatagaggag
cagaaggaggagcggcgacgtgtagaggagcaacagcggcgagagcgagaacagcgcaag
ctgcaggagaaggagcagcagcggcggttggaagacatgcaagcccttcgtcgagaggaa
gagaggcggcaagcagagcgggaacaggaatacaagcggaagcagctggaggagcagcgg
cagtcggagcggctccagagacagctgcagcaggagcatgcctacctcaagtccctgcag
cagcagcagcaacagcagcagcagctccagaaacaacagcagcagcagcagcagcagcag
cagcagcagcagcagcagcagatcctacctggagacaggaaacccctgtatcattatggt
cggggcattaatcctgctgacaagccagcatgggcccgagaggtggaagagagagctcgg
atgaacaagcagcagaactctcccttggccaagacaaagccaagcagtgcggggccagag
ccccccattccccaggcctctcctagccccccaggacctctttcccaaactcctcctatg
cagaggcctgtggagcctcaggaaggaccacacaagagcctggtggcacaccgggtccca
ctgaagccatatgcagcacctgtaccccgatcccagtccctgcaggaccaacccactcga
aacttggctgccttcccagcctcccacgaccctgaccctgctgctgtccccacacccact
gccacacccagtgcccgaggagctgtcatccgccagaattcagaccccacctctgaaggg
cctgggcctagccctaaccctccatcctgggtccggcctgataatgaagctccacccaag
gttcctcagaggacctcgtctattgccactgcccttaacaccagtggggctggagggtcc
cggccagctcaggctgtccgtgccagacctcgcagcaactccgcctggcaaatctatctg
cagaggcgggcagagcgaggcacccccaagcctcctgggcccccagctcagccccctggc
ccgcccaacacctctagtaaccctgacctcaggaggagtgaccctggctgggagcgttca
gacagtgtcctccctgcctcccacggccacctccctcaggccggctccttggagcggaac
cgaaaccgtgtgggagcctccacaaaactggacagctccccagtgctctcccctgggaac
aaggccaagcctgaagaccaccgctcaaggccaggccggcccgcaagctataagcgagcg
attggtgaggatttcgtgttgctcaaagagcggactctggatgaggcccctaagcctccc
aagaaggccatggactattcctcatccagtgaggaggtggagagcagtgaagatgaggag
gaggaaggcgatggggagccatcagaggggagcagagacactcccgggggccgtgatggt
gacacagatagcgtcagcaccatggtggttcatgatgttgaagaggtatccgggacccag
ccttcatatggaggaggcaccatggtggtccagcgtactcctgaagaggagcgaagcctg
ctgcttgctgatagcaatggctacacaaacctgccagatgtggtccagcccagccactca
cctactgagaacagccaaggtcaaagccctccaacaaaggatggaggcggtgattaccag
tctcgtgggctggtaaaggccccaggaaagagttcattcaccatgtttgtggatctaggg
atctaccagcctggaggcagtggggataccatccccatcacagccctagtgggcggagag
ggtggtcgccttgatcaactgcagttcgatgtgaggaagggctctgtggtcaacgtcaat
cccaccaacactcgagctcatagtgaaactcccgagattcgcaagtacaagaagcgattc
aattccgagatcctctgtgcagccctctggggggtcaacctcctagtgggcacagagaat
gggctgatgttgctggaccgaagtgggcagggcaaagtgtatggacttattgggcgacga
cgcttccagcaaatggatgttctggaagggctcaacctgctcatcaccatctcagggaaa
aggaacaaactgcgggtatattacctgtcctggcttcggaataagattctacacaatgac
ccagaggtggaaaagaagcaggggtggaccaccgtgggggacatggagggctgcggccac
tatcgtgttgtgaaatatgaacgaattaagttcctggtcattgctctgaagaactctgtg
gaggtgtatgcctgggcccctaaaccctaccacaaattcatggccttcaagtcctttgct
gacctccctcaccgccctctgctggtggacctgacagtagaggagggccagcggctcaag
gtcatctatggctccagtgctggcttccatgctgtggatgttgactctgggaacagctat
gacatctacatccctgtacatatccagagccaaatcacaccccacgccatcgtctttctc
cccaacactgacggcatggagatgctgctttgctatgaagatgagggtgtctacgtcaac
acttacgggcggatcatcaaggacgtggtgctgcagtggggagagatgcccacctctgtc
gcctacatctgctccaaccagataatgggctggggtgagaaggccatagagatccgctct
gtggagacaggccacctagatggggtcttcatgcacaaacgagcccagaggctcaagttc
ctgtgtgagcggaatgataaggtgttttttgcctcagtccgctctggaggaagcagccaa
gtttactttatgactctgaaccgtaactgcatcatgaactggtga

DBGET integrated database retrieval system