KEGG   Rattus norvegicus (rat): 303298
Entry
303298            CDS       T01003                                 

Gene name
Rap1gap2, Garnl4
Definition
(RefSeq) RAP1 GTPase activating protein 2
  KO
K17708  RAP1 GTPase activating protein 2
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    303298 (Rap1gap2)
SSDB
Motif
Pfam: Rap_GAP SCF
Other DBs
NCBI-GeneID: 303298
NCBI-ProteinID: NP_001100489
RGD: 1304590
Ensembl: ENSRNOG00000002652
UniProt: D3ZPI4
Position
10q24
AA seq 410 aa
MIVSYDEHDVNNTFKFGVIYQKARQTLEEELFGNNEESPAFKEFLDLLGDTITLQDFKGF
RGGLDVTHGQTGVESVYTTFRDREIMFHVSTKLPFTDGDTQQRKRHIGNDIVAIIFQEEN
TPFVPDMIASNFLHAYIVVQAESTGTETPSYKVSVTAREDVPAFGPPLPSPPVFQKGTEF
REFLLTKLTNAENACCKSDKFAKLEDRTRAALLDNLHDELHTHTQVMLGMGPEEDKFENG
GHGGFLESFKRAIRVRSHSMETMVGSQRKLHGGNIPGSLSGGIVHNSMEVTKTTFSPPVA
AATVKNQSRSPIKRRSGLFPRLHSGSEGQGDSRTRCDSASSTPKTPDGGHSSQEIKSETS
SNPSSPEICPNKEKAASRPQPRPSSRRCLSTARPPAARAPAWGPLPRPSS
NT seq 1233 nt   +upstreamnt  +downstreamnt
atgattgtgtcctatgatgagcatgatgtcaacaacactttcaagtttggggttatttat
cagaaagccaggcagaccctggaagaggagctatttgggaacaatgaggagagcccagct
ttcaaggagtttttggatctcttgggggacaccatcacactgcaggatttcaaaggtttc
cgaggaggcctggatgtgacccatggacagacaggggtggagtcggtgtacaccactttc
cgggaccgggagatcatgttccatgtctctaccaagctgcccttcacggatggtgacacc
cagcagagaaagcgacatattgggaatgacatcgtggccatcatctttcaagaagaaaac
actccatttgtcccagatatgatcgcatcaaacttcttacatgcctacattgtcgtccag
gctgaaagcacaggcacggagaccccatcctacaaggtatcagtcactgcgagggaagat
gtgcctgcctttggcccccctctgccaagcccgcctgttttccagaagggcacagaattc
cgggagtttctgctcaccaagctcacgaatgcagagaatgcttgctgcaagtcggacaag
tttgccaagctggaggaccggacccgggctgctctcctggacaaccttcacgatgagctc
cacacacatactcaggtcatgctaggcatgggcccagaggaggacaagtttgagaacggg
ggccatggaggattcctggagtcttttaagagagccatccgagtgcgcagccattccatg
gagaccatggtgggcagccagaggaagctgcatggtgggaacattcctggcagcctcagt
ggaggtattgtccacaacagcatggaggtcaccaagaccaccttctcgcctccagtggcc
gcagcaaccgtgaagaaccagtcacggagccccatcaagcggcggtcgggactcttcccc
cgcctgcactcaggctctgaaggccagggggacagccggacacgatgtgacagtgcctcc
agcacccccaaaaccccagatggcggacactcttctcaggagataaagtcggagacctcg
tcaaatcccagctctccagaaatctgtcccaacaaagagaaagcagccagccgtccacaa
cctcgcccttcaagcaggaggtgtttgtctacagcccgtcccccagcagcgagagcccca
gcctgggggccgctgccacgcccatcatcatga

DBGET integrated database retrieval system