KEGG   Rattus norvegicus (rat): 303353Help
Entry
303353            CDS       T01003                                 

Gene name
Psmd11
Definition
(RefSeq) proteasome 26S subunit, non-ATPase 11
  KO
K03036  26S proteasome regulatory subunit N6
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03050  Proteasome
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    303353 (Psmd11)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    303353 (Psmd11)
   05012 Parkinson disease
    303353 (Psmd11)
   05016 Huntington disease
    303353 (Psmd11)
   05017 Spinocerebellar ataxia
    303353 (Psmd11)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    303353 (Psmd11)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:rno03051]
    303353 (Psmd11)
Proteasome [BR:rno03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     303353 (Psmd11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPN6_N PCI TPR_12
Motif
Other DBs
NCBI-GeneID: 303353
NCBI-ProteinID: NP_001100497
RGD: 1306450
Ensembl: ENSRNOG00000005538
UniProt: D3Z950
Structure
PDB: 

Position
10q26
AA seq 445 aa AA seqDB search
MMEWLFVFFLTDGREMAIGSSYAAFGTLLVHPLRRETTTPGVLGEGRRGLRVGTRGLVFR
VCVSGVGGRGRGRCESGKMAAAAVVEFQRAQSLLSTDREASIDILHSIVKRDIQENDEEA
VQVKEQSILELGSLLAKTGQAAELGGLLKYVRPFLNSISKAKAARLVRSLLDLFLDMEAA
TGQEVELCLECIEWAKSEKRTFLRQALEARLVSLYFDTKRYQEALHLGSQLLRELKKMDD
KALLVEVQLLESKTYHALSNLPKARAALTSARTTANAIYCPPKLQATLDMQSGIIHAAEE
KDWKTAYSYFYEAFEGYDSIDSPKAITSLKYMLLCKIMLNTPEDVQALVSGKLALRYAGR
QTEALKCVAQASKNRSLADFEKALTDYRAELRDDPIISTHLAKLYDNLLEQNLIRVIEPF
SRVQVRISLGTLSTVLGYMLCCCPK
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgatggaatggttatttgtgttctttctcactgatggacgcgagatggcgatcgggagc
tcgtatgcggctttcgggacgctcctggtccacccgctccggagagaaactacaactccc
ggagtgctcggagaagggaggcggggtcttcgggtaggaacgcgagggctggtcttccgg
gtgtgtgtttccggcgtcggcggccgcggccggggacggtgtgagagcggtaagatggcg
gccgcagcggtggtagagttccagagagctcagtctctactcagcactgaccgggaggcc
tccatcgacatcctccactccatcgtgaagcgtgacattcaagaaaatgatgaggaggca
gtccaggtcaaagagcagagcatccttgaactggggtctctcctggcgaagactggacaa
gctgctgagcttggaggactcctgaagtatgtacgacctttcttgaattccatcagtaaa
gctaaagcagctcgtctggtccggtctcttcttgatctgtttctagatatggaagcagct
acagggcaggaggtcgagctatgtttagaatgcatcgaatgggccaaatcagagaaaaga
accttcttacgccaagcattggaggcaaggctggtgtctttgtattttgataccaagagg
taccaggaagcattacatttgggttctcagctgcttcgggagttgaaaaagatggatgat
aaagctcttttggttgaagtacagcttttagaaagcaaaacttaccatgctctgagtaat
ctgccgaaagcccgagctgccttaacctctgctcgaaccacagcaaatgctatctactgc
ccccctaaattgcaggccactctggacatgcagtcaggtattattcatgcagcagaggag
aaggactggaaaactgcatactcgtacttctatgaggcattcgaaggctatgactccatc
gatagccccaaggccatcacatctctgaagtacatgttgctgtgcaaaatcatgctcaac
accccagaagatgtccaggctttggtgagcggaaagcttgcacttcggtatgcagggagg
cagacagaagcattgaaatgtgtggctcaagctagcaagaacagatcactggcagatttt
gaaaaggccctgacagactacagggcggagctccgggacgacccaatcatcagcacacat
ttggccaagttgtacgataacttactggaacagaatctgatccgggtcattgaacctttc
tcccgagtacaggtcagaatctccctgggaactttgtcaacagttttgggctacatgttg
tgctgttgtccaaaatag

DBGET integrated database retrieval system