KEGG   Rattus norvegicus (rat): 303369Help
Entry
303369            CDS       T01003                                 

Gene name
Lig3
Definition
(RefSeq) DNA ligase 3
  KO
K10776  DNA ligase 3 [EC:6.5.1.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    303369 (Lig3)
Enzymes [BR:rno01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     303369 (Lig3)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Short Patch-BER factors
     303369 (Lig3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N zf-PARP DNA_ligase_A_C RNA_ligase mRNA_cap_enzyme
Motif
Other DBs
NCBI-GeneID: 303369
NCBI-ProteinID: NP_001012011
RGD: 1309875
Ensembl: ENSRNOG00000021815
Vega: OTTRNOG00000000454
UniProt: Q5U2M4
Position
10q26
AA seq 943 aa AA seqDB search
MTLAFKTLFPRNLCALGRKELCLFSEQHHWPAIRQFSQWSETNLLCGCCLLQRRKPVLSF
QRGHLRPRATHLISWSGSHVGLCTGPCEMAEQRFCVDYAKRGTAGCKKCKEKIVKGVCRI
GKVVPNPFSESGGDMKEWYHIKCMFEKLERARATTKKIEDLTELEGWEELEDNEKEQISQ
HIADLSSKTAATPKKKATVQAKLTTTGQVTSPVKGASFITSTNPRKFSGFSAAKPNNSEQ
DPSSPAPKTSLSASKCDPKHKDCLLREFRKLCAMVAENPSYNTKTQIIHDFLQKGSTGDG
FRGDVYLTVKLLLPGVIKSVYNLNDKQIVKLFSRIFNCNPDDMARDLEQGDVSETIRVFF
EQSKSFPPAAKSLLTIQEVDAFLLHLSKLTKEDEQQQALQDIASRCTANDLKCIIRLIKH
DLKMNSGAKHVLDALDPNAYEAFKASRNLQDVVERVLHNEQEVEKDPGRRRALSVQASLM
TPVQPMLAEACKSIEYAMKKCPNGMFSEIKYDGERVQVHKKGDHFSYFSRSLKPVLPHKV
AHFKDYIPKAFPGGQSMILDSEVLLIDNNTGKPLPFGTLGVHKKAAFQDANVCLFVFDCI
YFNDVSLMDRPLCERRKFLHDNMVEIRNRIMFSEMKQVTKASDLADMINRVIREGLEGLV
LKDVKGTYEPGKRHWLKVKKDYLNEGAMADTADLVVLGAFYGQGSKGGMMSIFLMGCYDP
DSQKWCTVTKCAGGHDDATLARLQKELDMVKISKDPSKIPSWLKINKIYYPDFIVPDPKK
AAVWEITGAEFSRSEAHTADGISIRFPRCTRIRDDKDWKSATNLPQLKELYQLSKDKADF
AVVAGDEGSSTTGGSNGENEGTAGSTVPRKGPKGPPSKSSASAKKTEQKLNDPSSRGGEK
LAVKSSPVKVGMKRKAADETPGLTKRRRASRQRGRRAMRTGRR
NT seq 2832 nt NT seq  +upstreamnt  +downstreamnt
atgactttggcctttaagaccctcttcccgagaaacctctgtgcccttggcagaaaagaa
ctgtgcctgttttcagaacagcatcactggcctgccataagacagttcagccagtggtcg
gaaacaaatctcctttgtgggtgctgcctcctccagagaagaaagcctgtcctatctttc
cagagaggtcatctaagaccacgtgccacccaccttatttcgtggtcagggtcgcatgtg
ggactctgtactggcccctgtgagatggccgaacagcggttctgtgtggactatgccaag
cggggcacagctggctgcaagaaatgcaaggagaagattgtaaagggcgtatgccgcatt
ggcaaagtggtacccaatcccttctcagagtctgggggtgatatgaaagagtggtaccac
attaagtgcatgtttgagaaactggagcgggcgcgggccaccacaaaaaaaattgaagac
ctcacagagctggaaggctgggaagagctggaagataatgaaaaggaacagataagccag
cacattgcagacctgtcttccaagacagctgccacaccgaagaagaaagctactgtccag
gctaagctgacaaccactggccaagtgacatcaccagtgaaaggcgcttcgtttattacc
agtaccaatccccggaaattttctggcttttcagcagccaaaccgaacaactctgagcaa
gacccctcaagccctgctcctaagaccagtctgtccgcaagtaaatgtgaccctaagcac
aaagattgtctactacgagaattccggaagctgtgtgccatggtagctgaaaatcctagc
tataacaccaagacccagatcatccacgacttcttgcagaaaggctccacaggagatggc
ttccgaggcgatgtgtacctgacagtgaagctgctgctgcctggtgtcatcaagagtgtg
tacaacttgaatgataagcagatagtgaaactgttcagccgaatttttaactgcaaccca
gatgatatggcccgggacctagaacagggtgacgtgtccgagacgatcagagtcttcttt
gagcagagcaagtcttttcccccagctgccaaaagcctcctcaccatccaggaggtggat
gcatttcttctgcacctctccaagctcaccaaagaggatgagcagcagcaggccctgcag
gacattgcttccaggtgtacagccaatgaccttaagtgcattatccggctgatcaaacac
gatctgaagatgaactcgggtgcaaaacacgtgttagatgcccttgaccccaatgcttat
gaagccttcaaagcatcacgcaacctgcaggatgtggtggagcgggtccttcacaatgag
caggaggtggagaaggacccaggccggcgtcgggctctgagtgtccaggcctcattgatg
acacctgtgcaacccatgctggctgaggcctgcaagtccattgagtatgcaatgaagaag
tgtcccaatggcatgttctctgagatcaagtacgatggtgagcgagtccaggtgcataag
aagggagaccatttcagctacttcagccgcagtctcaagcctgtcttgcctcacaaggtg
gcccactttaaggactatattcccaaagcgtttcctgggggtcaaagcatgatcttggac
tctgaagtgctcctgattgataacaacacaggcaaaccactgccctttgggaccctggga
gtacacaagaaagctgctttccaggatgctaatgtctgcctgtttgtttttgattgtatc
tactttaatgatgtcagcttgatggacaggcctctctgtgagcgacggaagtttcttcat
gataacatggttgaaatccgtaaccggatcatgttctcagaaatgaagcaagtcacaaaa
gcttcagacctggctgacatgataaaccgggtgatccgagagggcctggaaggtttggtg
ctaaaggatgtgaagggtacatatgagcctggaaaacgacactggctgaaagttaagaaa
gactatttgaacgagggggccatggctgatacagctgatctggtggttcttggggccttc
tatgggcaagggagcaaaggtggaatgatgtccatcttcctcatgggctgctatgacccc
gacagccagaagtggtgcactgttacaaaatgtgctggaggccatgacgatgccacactt
gcccgcctgcagaaagagctagatatggtgaagattagcaaggatcctagcaagataccc
agctggctgaagatcaacaagatctactatcctgactttatcgtcccagacccaaagaaa
gctgctgtgtgggagatcacaggagcagaattctctcgatctgaggcgcatactgctgat
gggatctccatccgatttcctcgatgcacccgaatccgggatgacaaggactggaaatct
gccactaacctcccccaactcaaggaactgtaccagctgtccaaagacaaggcagacttc
gctgtggtggctggagatgaggggagctccactactggaggcagcaatggtgagaatgag
ggcactgctgggtctactgtgccccgcaagggccccaagggaccccccagtaagtcctct
gccagtgccaagaagactgaacagaagctgaatgatcccagtagcagaggtggagagaag
ctggctgtgaagtcttctcctgtcaaagtggggatgaagaggaaagctgctgatgagacc
ccaggcctgacaaagaggcggcgggccagccggcaaagaggaaggagagctatgcgaaca
ggcaggagatag

DBGET integrated database retrieval system