KEGG   Rattus norvegicus (rat): 303373
Entry
303373            CDS       T01003                                 

Gene name
Unc45b, Cmya4
Definition
(RefSeq) unc-45 myosin chaperone B
  KO
K21991  protein unc-45
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rno03110]
    303373 (Unc45b)
Chaperones and folding catalysts [BR:rno03110]
 Other chaperones and cochaperones
  Others
   303373 (Unc45b)
SSDB
Motif
Pfam: UNC45-central Arm
Other DBs
NCBI-GeneID: 303373
NCBI-ProteinID: NP_001100498
RGD: 1305666
Ensembl: ENSRNOG00000009466
Vega: OTTRNOG00000000461
UniProt: D4A8U9
Position
10q26
AA seq 735 aa
MFEILLNENSEADKREKAANNLIVLGREEAGAERIFQSNGVALLLQLMDAKRPELVLAAV
RTLSGMCSGHRARATAILHAVRIDRICSLMALENEEMSLAVCSLLQAIIDSLSGEDKREH
RGKEEALVLGLRKVLKVVGQVPDLPSCLPLTDNTRMLASILINKLYEDLRCDPERDHFRK
ICEEYITSKFDPQDMDKNVNAIQTVSGILQGPFDLGNQLLGMKGVMEMMVALCGSEREAD
QLVAVEALIHASTKLSRATFIITNGVTLLKQIYKTTKNEKIKIRTLVGLCKLGSAGGSDY
GLRQFAEGSTEKLAKQCRKWLCNTAIDTRTRRWAVEGLAYLTLDADVKDDFVQDIPALQA
MFELAKARTTSDKTILYSVANTLVNCTNSYDVKEVVPELVQLAKFSKQHVPEEHPKDKKD
FVDLRVKRLLKAGVISALACMVKADSAILTDQTKELLARVFLALCDNPKDRGTIVAQGGG
KALIPLALEGTDVGKVKAAHGLAKIAAVSNPDIAFPGERVYEVVRPLVSLLDTQRDGLQN
YEALLGLTNLSGRSDKLRQKIFKEKALPDIENYMFENHDQLRQAATECMCNMVLNKEVQE
RFLADGNDRLKLVVLLCGEDDHKLQNAAAGALAMLTAAHKKLCLKMTEVTTQWLEILQRL
CLHDQLSVQHRGLVIAYNLLSADAELARKLVETELLEILTVVGKQEPDETRAAVVQTARE
CLIKCMDYGFIKPVS
NT seq 2208 nt   +upstreamnt  +downstreamnt
atgtttgaaatccttctgaacgaaaacagcgaggcagataagcgggagaaggctgccaac
aaccttattgtcctgggccgtgaagaagcaggggctgagaggatcttccagagcaatgga
gtagctctgctgctacagcttatggacgctaaacggcctgagctggtgctcgctgctgtg
cggaccctgtctggcatgtgcagtggccacagagctagggccacagcgatcctgcacgca
gtccgcatagacagaatctgtagcctcatggccctggagaatgaagagatgtccctggct
gtgtgcagcctgctccaagccatcattgactccctctctggggaagacaagagagagcat
cgtgggaaggaggaggccttggttttaggtctgaggaaggtcctgaaggtggtggggcag
gttccagatcttccctcctgcttgccactgactgacaacacccgcatgctggcctctatc
ctcatcaacaagctttacgaggacctgcgctgtgacccagagcgcgaccacttccgcaag
atctgtgaggagtacatcacgagcaagtttgatccccaggacatggacaagaacgtaaac
gccatccagacagtgtcgggcatcttgcaggggccctttgacctgggcaatcagctgctg
ggcatgaaaggtgtgatggagatgatggtggctctgtgtggttcagagcgtgaggcagac
cagctggtggctgtggaggccctcattcacgcctccactaagctcagccgggccactttc
atcatcaccaacggcgtgacacttctcaagcagatctacaagaccacaaagaacgagaag
atcaagatccgcacgctggtggggctttgtaaacttggctcagctgggggctccgactat
ggcctcagacagtttgctgagggctcgacagagaagctagcgaagcagtgtcgaaagtgg
ctgtgcaataccgccatagacactcggacacggcgctgggcagtggagggcctggcctac
ctcaccctggatgctgatgtgaaggatgactttgtccaggacatccccgctctgcaggct
atgttcgagttggccaaggcaagaacgaccagtgacaagaccatcctgtactcagtggcc
aacactctggtaaactgcaccaacagctatgatgtcaaggaggtcgtccctgagctggtg
cagctggccaagttctccaagcagcatgtgcccgaggagcaccccaaggacaagaaggac
ttcgtagacttgcgggtgaaacggctcctgaaggcaggcgtcatatcggcactggcctgc
atggtgaaggcagacagtgctatcctcacagaccagaccaaggagctgctggccagggtg
ttcctggcactctgtgacaacccaaaggaccggggcaccattgtagctcaaggtggtggc
aaggccctgatccccctggctttggagggcacagatgtgggcaaggtgaaggcagcccat
ggactagccaagatcgctgctgtctccaatcctgatatcgccttccctggggagcgggta
tatgaggtggtgcggcccctcgtgagtctcctggacacacagagggatgggcttcagaac
tatgaggctctcctaggactcactaatctgtctgggcgcagtgacaaactcaggcagaag
atcttcaaagagaaagccttgccagacattgagaactacatgtttgagaaccatgaccag
ctacggcaggctgccaccgaatgcatgtgtaacatggtgctcaataaggaggttcaggag
aggttcctggccgatgggaatgaccgtcttaagctggtggtactgctctgtggggaggat
gaccacaaactgcagaatgcagcagctggagctctggccatgttgacggcggcgcataag
aaactgtgcctcaagatgacggaggtgacaacccagtggctggagatcctacagcgactt
tgcctgcacgaccagttgtcagtgcagcaccggggcctggtcattgcctacaacctgctc
tcggcggatgctgagctggctaggaaactggtggagacggagctgctggagatcctgacg
gtggtggggaagcaggagccagatgagacgagagcagctgtggtccagacagcccgggag
tgtcttatcaagtgcatggactacggcttcatcaagccggtgtcctag

DBGET integrated database retrieval system