KEGG   Rattus norvegicus (rat): 303375
Entry
303375            CDS       T01003                                 

Gene name
Rad51d, Rad51l3
Definition
(RefSeq) RAD51 paralog D
  KO
K10871  RAD51-like protein 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    303375 (Rad51d)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rno03400]
    303375 (Rad51d)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecA family proteins
     303375 (Rad51d)
SSDB
Motif
Pfam: Rad51 AAA_25 DnaB_C ATPase HHH_5 RecA AAA_22 AAA_19 AAA_24 AAA_5 DUF2075 AAA CbiA ABC_tran PAXNEB CobU GvpD AAA_11 AAA_33 ATPase_2 CbiG_N AAA_18
Other DBs
NCBI-GeneID: 303375
NCBI-ProteinID: NP_001100499
RGD: 1306944
Ensembl: ENSRNOG00000021780
Vega: OTTRNOG00000000458
UniProt: B5DFH5
Position
10q26
AA seq 329 aa
MGMLRAGLCPGLTEEIVQLLRGRKIKTVADLAAADLEEVAQKCGLSYKALVALRRVLLAQ
FSAFPLNGADLYEELKTSTAILSTGIGSLDKLLDAGLYTGELTEIVGGPGSGKTQVCLCV
AANVAHSLQQNVLYVDSNGGMTASRLLQLLQARTQDEEKQASALQRIQVVHSFDIFQMLD
MLQDLRGTMAQQATASSGTVKVVIVDSVTAVVAPLLGGQQREGLALMMQLARELKILARD
LGVAVVVTNHLTRDRDSRRFKPALGRSWSFVPSTRILLEVFEGAGTLGRSQRTVRLIKSP
RQPTGLQEVIDIGTLGTEEQSPELPGKQT
NT seq 990 nt   +upstreamnt  +downstreamnt
atgggcatgctcagggcagggctgtgcccgggcctcaccgaggagatcgtccagcttctg
aggggccgaaagatcaaaacagtggcagacctggcagctgctgacttggaggaggtagcc
cagaagtgtggtctgtcctacaaggccctggttgccctgaggagagtgttgctggcgcag
ttctcggctttccccttaaatggtgcagatctctatgaggaactgaagacttccactgcc
atcctgtccaccggcatcggaagcctggacaaactacttgatgctggcctctatactggg
gagctgactgaaattgtgggtggcccaggtagtggcaaaactcaggtgtgtctctgtgtg
gctgcaaatgtggcccacagcctgcaacagaatgtactgtatgtggattccaatggagga
atgacagcgtcccgcctcctccagctactacaagctagaacccaagatgaggagaaacag
gcaagtgctctccagaggatacaggtggtgcattcatttgacatcttccagatgttagac
atgctgcaggaccttaggggcaccatggcccagcaggcgacagcttcttcaggcactgtg
aaggttgtgattgtggattctgtcactgcagtggtcgccccacttctgggaggtcagcag
agggaaggcctggccttgatgatgcagctggcccgagagctcaagatcctggctcgggac
ctgggtgtggcagtggtggtaaccaaccacttgactcgagacagggacagtagaagattc
aaacctgcccttggacgctcctggagctttgtgcccagtacccggattctcctggaagtc
tttgagggagctggaacactaggccgcagccaacgcacagtacgtctgatcaagtctccc
cgccagccaacgggtctgcaggaggtgatagacattgggacattggggactgaggagcag
agcccagaattgcctggcaaacagacgtga

DBGET integrated database retrieval system